(data stored in ACNUC7421 zone)

EMBL: CP002343.PE207

CP002343.PE207       Location/Qualifiers
FT   CDS             complement(227343..227855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0212"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR017867: IPR000106; KEGG: sco:SCO3921 low molecular
FT                   weight protein-tyrosine-phosphatase; PFAM: Protein-tyrosine
FT                   phosphatase, low molecular weight; SMART: Protein-tyrosine
FT                   phosphatase, low molecular weight; SPTR: Protein tyrosine
FT                   phosphatase; manually curated; PFAM: Low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46769"
FT                   /db_xref="GOA:E6S629"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E6S629"
FT                   /protein_id="ADU46769.1"
FT                   /translation="MPSPRPFHVTFVCSGNICRSPMGHVILEQLVAEAGLADAVTVSSS
FT                   GTGDWHVGERADPRTVDVLAHHGYDGSGHRAREFDATAFDDIDLVLASDDGHVRHLRRL
FT                   APTSDHRSRIRLVREFDPTAVAAGTLETSDPWYGDEEHFRRCFTEVEAACKGVLEHIRG
FT                   RLEMEHP"
     MPSPRPFHVT FVCSGNICRS PMGHVILEQL VAEAGLADAV TVSSSGTGDW HVGERADPRT        60
     VDVLAHHGYD GSGHRAREFD ATAFDDIDLV LASDDGHVRH LRRLAPTSDH RSRIRLVREF       120
     DPTAVAAGTL ETSDPWYGDE EHFRRCFTEV EAACKGVLEH IRGRLEMEHP                  170
//

If you have problems or comments...

PBIL Back to PBIL home page