(data stored in ACNUC7421 zone)

EMBL: CP002343.PE209

CP002343.PE209       Location/Qualifiers
FT   CDS             228372..229718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0214"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: cmi:CMM_2049 putative MFS
FT                   permease; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   Putative MFS permease; PFAM: Bacterial protein of unknown
FT                   function (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46771"
FT                   /db_xref="GOA:E6S631"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S631"
FT                   /protein_id="ADU46771.1"
FT                   /translation="MVDGSETREGATARRSHLVDISPLRASLPFARLWAGNTLAGIGAQ
FT                   VTATAVALHIYDLTASTFMVSLVAWFALGPVIASGLYGGAVADRFDRRSVALIASVVAW
FT                   ASTVSLAAIAWAGVTTVWAFYVITTVNAVAATIASATRQAITPRLLPLHLLPQAAALTG
FT                   ISMGLMVTAGPGLAGVLVARVGYAWTYTVDVLLFVAGLFGLWTLPRIRPELDEDGAPPA
FT                   SGLRAVVEGLAHLRTAPNVRMSFVVDIIAMTFGHPMVLFPAVGAVVIGGGPVTAGLLLA
FT                   AFAAGGILSSLGSGRVTGARWQGRAIRNAIIVYGVAILGFGMVLAVVMVGGHAVSSRDF
FT                   GDADRTALVAAVVCLAVAGGADNVSSIFRQSILQAAVPDRLRGRMQGIFTVVVTGGPRL
FT                   GQMLAGSLATLTVTWVPPVVGGALVVGLVVLAVARVPSFRDYDALDPRP"
     MVDGSETREG ATARRSHLVD ISPLRASLPF ARLWAGNTLA GIGAQVTATA VALHIYDLTA        60
     STFMVSLVAW FALGPVIASG LYGGAVADRF DRRSVALIAS VVAWASTVSL AAIAWAGVTT       120
     VWAFYVITTV NAVAATIASA TRQAITPRLL PLHLLPQAAA LTGISMGLMV TAGPGLAGVL       180
     VARVGYAWTY TVDVLLFVAG LFGLWTLPRI RPELDEDGAP PASGLRAVVE GLAHLRTAPN       240
     VRMSFVVDII AMTFGHPMVL FPAVGAVVIG GGPVTAGLLL AAFAAGGILS SLGSGRVTGA       300
     RWQGRAIRNA IIVYGVAILG FGMVLAVVMV GGHAVSSRDF GDADRTALVA AVVCLAVAGG       360
     ADNVSSIFRQ SILQAAVPDR LRGRMQGIFT VVVTGGPRLG QMLAGSLATL TVTWVPPVVG       420
     GALVVGLVVL AVARVPSFRD YDALDPRP                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page