(data stored in ACNUC7421 zone)

EMBL: CP002343.PE21

CP002343.PE21        Location/Qualifiers
FT   CDS             23320..23652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1746 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46583"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDY0"
FT                   /protein_id="ADU46583.1"
FT                   /translation="MNIDRMLGIAVRTSADFGDGAWTPGMPLQQGWLWAGTVEGDTVLA
FT                   FELGPGRVLFGFTPDELRSVRKVASGFNTVVECVVAEENGSPRTFTLVGPRGRIKKAFQ
FT                   HIGKPI"
     MNIDRMLGIA VRTSADFGDG AWTPGMPLQQ GWLWAGTVEG DTVLAFELGP GRVLFGFTPD        60
     ELRSVRKVAS GFNTVVECVV AEENGSPRTF TLVGPRGRIK KAFQHIGKPI                  110
//

If you have problems or comments...

PBIL Back to PBIL home page