(data stored in ACNUC7421 zone)

EMBL: CP002343.PE211

CP002343.PE211       Location/Qualifiers
FT   CDS             complement(231164..232060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0216"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="InterPro IPR001915; KEGG: msm:MSMEG_3631 integral
FT                   membrane protein; PFAM: peptidase M48 Ste24p; SPTR:
FT                   Putative uncharacterized protein; PFAM: Peptidase family
FT                   M48"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46773"
FT                   /db_xref="GOA:E6S633"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E6S633"
FT                   /protein_id="ADU46773.1"
FT                   /translation="MVIAALLTLTIALAWPVPRLMAGMTTFRRAPRAALVVWQSTTMGA
FT                   VLAALFAAPAALPYVIGPTAALADNATQIAVAVAVSGLIAGRLIVSGHRVGTRLRAHRR
FT                   RHRRLVDLLAVPVGADGSHAAHMRVIEHPTPTAYCVPGMRRRVVLTQGTLDSLPEDQLV
FT                   AVLAHERAHLRARHDLILEFFTVIHEAVPSWFRCEMAMHEVKLLIEVLADRAAVRATGV
FT                   VSTARAIVGMATGAVKPEGMLAMGESPSAARLRLELLQPGPVAGLPAGVAATVMYLFAT
FT                   SVVIMPVALLVVAWATA"
     MVIAALLTLT IALAWPVPRL MAGMTTFRRA PRAALVVWQS TTMGAVLAAL FAAPAALPYV        60
     IGPTAALADN ATQIAVAVAV SGLIAGRLIV SGHRVGTRLR AHRRRHRRLV DLLAVPVGAD       120
     GSHAAHMRVI EHPTPTAYCV PGMRRRVVLT QGTLDSLPED QLVAVLAHER AHLRARHDLI       180
     LEFFTVIHEA VPSWFRCEMA MHEVKLLIEV LADRAAVRAT GVVSTARAIV GMATGAVKPE       240
     GMLAMGESPS AARLRLELLQ PGPVAGLPAG VAATVMYLFA TSVVIMPVAL LVVAWATA         298
//

If you have problems or comments...

PBIL Back to PBIL home page