(data stored in ACNUC7421 zone)

EMBL: CP002343.PE213

CP002343.PE213       Location/Qualifiers
FT   CDS             complement(232501..234210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0218"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="COGs: COG4987 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis fused ATPase and permease
FT                   components; InterPro IPR003439: IPR014223: IPR003593:
FT                   IPR017940; KEGG: kse:Ksed_01870 cysteine export CydDC
FT                   family ABC transporter permease subunit/ATP-binding protein
FT                   CydC; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Putative ABC transporter ATP-binding protein;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydC; PFAM: ABC
FT                   transporter; TIGRFAM: thiol reductant ABC exporter, CydC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46775"
FT                   /db_xref="GOA:E6S635"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E6S635"
FT                   /protein_id="ADU46775.1"
FT                   /translation="MTGPVRPGSAPEHRGRIALAGLLGGIATASGVALTATSGWLIARA
FT                   AERPLILTLMTAIVAVRTFGIARPVFRYWERLVSHDASLATLAARRSAAYEALLPLTPA
FT                   RLGRRRRADVLTAVVHDITDEVEAQVRVTVPVVSSAVAGALAIGFTTVIAPPVGLVVAL
FT                   VCVAVALVSVLAHRTEARTLGALVAARAEVVRVSELVTTQADQLRAIGAWGTATRWLDE
FT                   AHDDVARATRTAVRGRALAAGTFLLVVATATIATAAVATGLELSNPVKALLVLTPVALA
FT                   DAIAPLADAMRARAQAGAAAARTDALLTQDPAVHDAGRAGPDGADTGPEPFGGLRLEAV
FT                   TASWGGSGGSAVPGDEQADGPVLGPFDLDLSPGETVAVVGPNGSGKSTLLAVLARHLDP
FT                   RAGRYETAADGRLRDVLTEPLDRARARVAVVDDEPHVFATSVRNNLTLARPGATDEDVL
FT                   RALDRAGLGRLVPSLPDGLDTVLGAGGRGLSGGERARLAIARAHLSRRPVIVLDEPVAH
FT                   LDPPTARSVLTDLLAQRRDTGDGGHPAVVLVTHRPEGLHLVDRVFTVTHPHR"
     MTGPVRPGSA PEHRGRIALA GLLGGIATAS GVALTATSGW LIARAAERPL ILTLMTAIVA        60
     VRTFGIARPV FRYWERLVSH DASLATLAAR RSAAYEALLP LTPARLGRRR RADVLTAVVH       120
     DITDEVEAQV RVTVPVVSSA VAGALAIGFT TVIAPPVGLV VALVCVAVAL VSVLAHRTEA       180
     RTLGALVAAR AEVVRVSELV TTQADQLRAI GAWGTATRWL DEAHDDVARA TRTAVRGRAL       240
     AAGTFLLVVA TATIATAAVA TGLELSNPVK ALLVLTPVAL ADAIAPLADA MRARAQAGAA       300
     AARTDALLTQ DPAVHDAGRA GPDGADTGPE PFGGLRLEAV TASWGGSGGS AVPGDEQADG       360
     PVLGPFDLDL SPGETVAVVG PNGSGKSTLL AVLARHLDPR AGRYETAADG RLRDVLTEPL       420
     DRARARVAVV DDEPHVFATS VRNNLTLARP GATDEDVLRA LDRAGLGRLV PSLPDGLDTV       480
     LGAGGRGLSG GERARLAIAR AHLSRRPVIV LDEPVAHLDP PTARSVLTDL LAQRRDTGDG       540
     GHPAVVLVTH RPEGLHLVDR VFTVTHPHR                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page