(data stored in SCRATCH zone)

EMBL: CP002343.PE214

CP002343.PE214       Location/Qualifiers
FT   CDS             complement(234207..235868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0219"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="COGs: COG4988 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis ATPase and permease components;
FT                   InterProIPR001140: IPR003439: IPR014216: IPR003593: IPR
FT                   017871: IPR017940; KEGG: kse:Ksed_01870 cysteine export
FT                   CydDC family ABC transporter permease subunit/ATP-binding
FT                   protein CydC; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase; SPTR:
FT                   Putative ABC transporter; TIGRFAM: ABC transporter, CydDC
FT                   cysteine exporter (CydDC-E) family, permease/ATP-binding
FT                   protein CydD; PFAM: ABC transporter transmembrane region;
FT                   ABC transporter; TIGRFAM: thiol reductant ABC exporter,
FT                   CydD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46776"
FT                   /db_xref="GOA:E6S636"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S636"
FT                   /protein_id="ADU46776.1"
FT                   /translation="MRPFDPRLLHVVPAARRPVAALAAIGIATGVTTIATAFALTGVVV
FT                   AVVDDRPVAAPATWLGILFAIRAVLAWATEVVAAWAGVSVSTALRSALVRRWGAGPAAA
FT                   GSAPVDQATALSLATSGASAVEPYAARYLPTLVTAAVVPVVAVLALAVVDWPSALIVVL
FT                   TVPLLPLFAALIGRATEDSTQRRWAALASLSGHFLDVVRGLPTLVGYGRGRRQVEVVRE
FT                   VSERHRRATMETLRIAFLSSAALELLATISVALVAVTVGLRLSYGSMDLTPALAAILLA
FT                   PEAYWPIRRVGQEFHAAADGATALDDILGALADPPSPSPTGAPFARVDLRDVSYTYAAG
FT                   LAPVIRDLDLVVGSGLYAITGPSGVGKTTLLDLIAGLKAASSGSLTAPPSHYVTQRPFL
FT                   AAGSIRANLTLADDAERNARSDDALWQALRTVGLDGVVAGLPEGLSTRLGDDGFGLSAG
FT                   QRQRLALARAWLAPEPLLLLDEPTAHLDPEVADTVNALIVELAERRIVVVVTHRPELVA
FT                   VADEHLHLLPLPEPDGPRDDLAIPGLTPGVRPEVAR"
     MRPFDPRLLH VVPAARRPVA ALAAIGIATG VTTIATAFAL TGVVVAVVDD RPVAAPATWL        60
     GILFAIRAVL AWATEVVAAW AGVSVSTALR SALVRRWGAG PAAAGSAPVD QATALSLATS       120
     GASAVEPYAA RYLPTLVTAA VVPVVAVLAL AVVDWPSALI VVLTVPLLPL FAALIGRATE       180
     DSTQRRWAAL ASLSGHFLDV VRGLPTLVGY GRGRRQVEVV REVSERHRRA TMETLRIAFL       240
     SSAALELLAT ISVALVAVTV GLRLSYGSMD LTPALAAILL APEAYWPIRR VGQEFHAAAD       300
     GATALDDILG ALADPPSPSP TGAPFARVDL RDVSYTYAAG LAPVIRDLDL VVGSGLYAIT       360
     GPSGVGKTTL LDLIAGLKAA SSGSLTAPPS HYVTQRPFLA AGSIRANLTL ADDAERNARS       420
     DDALWQALRT VGLDGVVAGL PEGLSTRLGD DGFGLSAGQR QRLALARAWL APEPLLLLDE       480
     PTAHLDPEVA DTVNALIVEL AERRIVVVVT HRPELVAVAD EHLHLLPLPE PDGPRDDLAI       540
     PGLTPGVRPE VAR                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page