(data stored in ACNUC7421 zone)

EMBL: CP002343.PE215

CP002343.PE215       Location/Qualifiers
FT   CDS             complement(235876..236949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0220"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="COGs: COG1294 Cytochrome bd-type quinol oxidase
FT                   subunit 2; InterPro IPR003317; KEGG: nca:Noca_0943
FT                   cytochrome d ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome bd ubiquinol oxidase subunit II; SPTR:
FT                   Cytochrome d ubiquinol oxidase, subunit II; TIGRFAM:
FT                   cytochrome d ubiquinol oxidase, subunit II; PFAM:
FT                   Cytochrome oxidase subunit II; TIGRFAM: cytochrome d
FT                   oxidase, subunit II (cydB)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46777"
FT                   /db_xref="GOA:E6S637"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:E6S637"
FT                   /protein_id="ADU46777.1"
FT                   /translation="MDLATFWFIVLGVLWTGYFVLEGFDFGVGILLPVLGRTKGAVGAA
FT                   AVDAEKRRRVLLNTIGPVWDGNEVWVLTAGGATFAAFPHWYATLFSGFYLPLLLILVAL
FT                   ILRNLGFEYRHKRGGAEWKSRWDLAIFWGSLVPAFLWGVALTNIVRGVPIDADMEYTGN
FT                   LFTLLGLVPILGGLTFVALFVTHGAIFVALKTDGPIRSDSRRIAERMGLVTVVLAVALL
FT                   LLLGISDGTAASWATTIVAAVALLGALQANRAGREGWAFLGTAVTIALAVATYFLMLFP
FT                   NVMPSSTNPAWNLTVDNASSSDYTLKVMTVVALIFTPLVLVYQAWTYWIFRKRLTVGHI
FT                   PEDVLPDRPDQPLQRVG"
     MDLATFWFIV LGVLWTGYFV LEGFDFGVGI LLPVLGRTKG AVGAAAVDAE KRRRVLLNTI        60
     GPVWDGNEVW VLTAGGATFA AFPHWYATLF SGFYLPLLLI LVALILRNLG FEYRHKRGGA       120
     EWKSRWDLAI FWGSLVPAFL WGVALTNIVR GVPIDADMEY TGNLFTLLGL VPILGGLTFV       180
     ALFVTHGAIF VALKTDGPIR SDSRRIAERM GLVTVVLAVA LLLLLGISDG TAASWATTIV       240
     AAVALLGALQ ANRAGREGWA FLGTAVTIAL AVATYFLMLF PNVMPSSTNP AWNLTVDNAS       300
     SSDYTLKVMT VVALIFTPLV LVYQAWTYWI FRKRLTVGHI PEDVLPDRPD QPLQRVG          357
//

If you have problems or comments...

PBIL Back to PBIL home page