(data stored in ACNUC7421 zone)

EMBL: CP002343.PE217

CP002343.PE217       Location/Qualifiers
FT   CDS             238634..239011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0222"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524; KEGG: nfa:nfa49100 putative
FT                   transcriptional regulator; PFAM: regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; SPTR: Putative
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46779"
FT                   /db_xref="GOA:E6S639"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S639"
FT                   /protein_id="ADU46779.1"
FT                   /translation="MTGPNDLSITIDPASAEPPFEQVRAQLAALIRSGRLLPGDRLPTV
FT                   RALAAHLGLAANTVARTYKELEAAGLVETRGRAGTVVASGEHTADVALAALAARYAVAA
FT                   REAGVDDATAVDLVRSALRSS"
     MTGPNDLSIT IDPASAEPPF EQVRAQLAAL IRSGRLLPGD RLPTVRALAA HLGLAANTVA        60
     RTYKELEAAG LVETRGRAGT VVASGEHTAD VALAALAARY AVAAREAGVD DATAVDLVRS       120
     ALRSS                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page