(data stored in ACNUC7421 zone)

EMBL: CP002343.PE221

CP002343.PE221       Location/Qualifiers
FT   CDS             complement(242416..243417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0226"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515: IPR010065:
FT                   IPR018062; KEGG: pfr:PFREUD_22920 polar amino acid ABC
FT                   transporter, inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Polar amino acid ABC transporter, inner
FT                   membrane component; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46783"
FT                   /db_xref="GOA:E6S643"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S643"
FT                   /protein_id="ADU46783.1"
FT                   /translation="MSVSPEQTPQVSLGTEDRPGAIHARPVPHPWRWVALAAIAVVVAM
FT                   VASSFLTNERWNFPQALRIMNFNPVLEGLLKGTLLGTAGAMVLGVVFGVAIAVMRLSAN
FT                   PVLRGVSFVFTWFFRAIPRYVLLVMMGSIGYLYPDLALGLPFGQQLAESLGWGTDLTFA
FT                   TVDVNRFSTGISTGIFLGIIGLGLSEAAYMAEIARAGILSVDKGQAEAAQALGMSSGKT
FT                   MRRIVLPQAMRVIVPPTGNETIAMVKDTSLLTAIPVQMELFNQTRIIGTRTLQIMPSLV
FT                   AAVGWYLIVCSVLMVGQYYLERYFGRGFGETRRQARKAQAKRAARPAGMGGA"
     MSVSPEQTPQ VSLGTEDRPG AIHARPVPHP WRWVALAAIA VVVAMVASSF LTNERWNFPQ        60
     ALRIMNFNPV LEGLLKGTLL GTAGAMVLGV VFGVAIAVMR LSANPVLRGV SFVFTWFFRA       120
     IPRYVLLVMM GSIGYLYPDL ALGLPFGQQL AESLGWGTDL TFATVDVNRF STGISTGIFL       180
     GIIGLGLSEA AYMAEIARAG ILSVDKGQAE AAQALGMSSG KTMRRIVLPQ AMRVIVPPTG       240
     NETIAMVKDT SLLTAIPVQM ELFNQTRIIG TRTLQIMPSL VAAVGWYLIV CSVLMVGQYY       300
     LERYFGRGFG ETRRQARKAQ AKRAARPAGM GGA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page