(data stored in ACNUC7421 zone)

EMBL: CP002343.PE224

CP002343.PE224       Location/Qualifiers
FT   CDS             complement(246324..247094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0229"
FT                   /product="RDD domain containing protein"
FT                   /note="COGs: COG1714 membrane protein/domain; InterPro
FT                   IPR010432; KEGG: gbr:Gbro_4825 RDD domain containing
FT                   protein; PFAM: RDD domain containing protein; SPTR:
FT                   Possible conserved membrane protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46786"
FT                   /db_xref="GOA:E6S646"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E6S646"
FT                   /protein_id="ADU46786.1"
FT                   /translation="MTGEGVALEVPVASIGTRVLSGLIDVVLHVGLLVGVFFAAGALTG
FT                   QSSEAVSRTAVIVSFVAVLVGVPTVSETLTRGKTLGKLITGLRVVRDDGGPISFRHALA
FT                   RALVGWVEVYLLTGVAAVIAALVTARTKRLGDLAAGTYVIAERSRLELPLPPVAPLALE
FT                   GWARRADIAPVAADLAVAVRQFLPRARLLVPEARQALGRQLLARVLPLVAPPPPPGNDP
FT                   EAILTAVMAERYRRDLERLHREQALRERALPDSR"
     MTGEGVALEV PVASIGTRVL SGLIDVVLHV GLLVGVFFAA GALTGQSSEA VSRTAVIVSF        60
     VAVLVGVPTV SETLTRGKTL GKLITGLRVV RDDGGPISFR HALARALVGW VEVYLLTGVA       120
     AVIAALVTAR TKRLGDLAAG TYVIAERSRL ELPLPPVAPL ALEGWARRAD IAPVAADLAV       180
     AVRQFLPRAR LLVPEARQAL GRQLLARVLP LVAPPPPPGN DPEAILTAVM AERYRRDLER       240
     LHREQALRER ALPDSR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page