(data stored in ACNUC7421 zone)

EMBL: CP002343.PE226

CP002343.PE226       Location/Qualifiers
FT   CDS             complement(248352..249647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0231"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: nca:Noca_3911
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46788"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S648"
FT                   /protein_id="ADU46788.1"
FT                   /translation="MVLTGRAALVVLLGAVAVAWRPGVGTVLLWTLGVLVLVLADLALA
FT                   PSPRGLVIERSVAPLVRLGEAVTSELLVTNPGRRAVRGQVRDAWQPSAGAEHDRHDLRL
FT                   RSGDRVRLTTRLRPTRRGDRHADLVTLRLHGPLGLAARQASITVAGTIRVLHPFHSRRH
FT                   LPSKLSRLRQIDGRSAVRRRGQGTEFDSLRDYVEGDDVRSIDWRATARRGSVVVRTWRP
FT                   EQHRRIVVVVDTSRTSAGRVGDVPRLDAAMDATLLLTALAGHAHDRVDVIAGDQRVRVR
FT                   VIGSTDRTSPLAEVVSALAPIQPAIVEADWSALASAVVSRHHQRSLVVLLTPLEPAAIE
FT                   EGLLPVIPTLVARHRVVLASVADPAVGTLLAERTTVADVYGAAAAERTMARRERVAAAL
FT                   ARLGVDVIDAEADELPARLADHYLWLKSEGLL"
     MVLTGRAALV VLLGAVAVAW RPGVGTVLLW TLGVLVLVLA DLALAPSPRG LVIERSVAPL        60
     VRLGEAVTSE LLVTNPGRRA VRGQVRDAWQ PSAGAEHDRH DLRLRSGDRV RLTTRLRPTR       120
     RGDRHADLVT LRLHGPLGLA ARQASITVAG TIRVLHPFHS RRHLPSKLSR LRQIDGRSAV       180
     RRRGQGTEFD SLRDYVEGDD VRSIDWRATA RRGSVVVRTW RPEQHRRIVV VVDTSRTSAG       240
     RVGDVPRLDA AMDATLLLTA LAGHAHDRVD VIAGDQRVRV RVIGSTDRTS PLAEVVSALA       300
     PIQPAIVEAD WSALASAVVS RHHQRSLVVL LTPLEPAAIE EGLLPVIPTL VARHRVVLAS       360
     VADPAVGTLL AERTTVADVY GAAAAERTMA RRERVAAALA RLGVDVIDAE ADELPARLAD       420
     HYLWLKSEGL L                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page