(data stored in ACNUC7421 zone)

EMBL: CP002343.PE228

CP002343.PE228       Location/Qualifiers
FT   CDS             complement(250674..251921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0233"
FT                   /product="secreted protein"
FT                   /note="KEGG: nca:Noca_3909 secreted protein; SPTR: Secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46790"
FT                   /db_xref="GOA:E6S6Q4"
FT                   /db_xref="InterPro:IPR025646"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q4"
FT                   /protein_id="ADU46790.1"
FT                   /translation="MSTRLPEATALPALPALPGGSPASAGPPARRRWGLAALLAVAGIV
FT                   AVGLLAVLSGGAGRSGTLGDPDSASRNGSRALAEVLRQQGVQVEVVRTIRAFEAARVDP
FT                   STTVVVGSFDYLGEAAAERTSRHSSSARRLVLLEPGDLALGDLGVPLVTTGGGRAELTG
FT                   GCNSDIVEADDRLDATTTVYASADDDGPALPRGATGCFPEKQSGVALVVLPASGAQPET
FT                   VVLGSADALTNARVGDASHAAVGLRSLGNSERLVWYVPGLSDLDVADASGEHRSSDRGV
FT                   PDWFDPGVLLLVIAFIAFALARGRRLGRIVTEPLPVVVRAVETTEARGRLYRRAGDRGR
FT                   AASSLRSGTRHRLAARLGLPTPTVGSDLVEAVARAAGRGTAEVRALLDGPAPTNDRDLV
FT                   LLAEQLAQLEENVRRA"
     MSTRLPEATA LPALPALPGG SPASAGPPAR RRWGLAALLA VAGIVAVGLL AVLSGGAGRS        60
     GTLGDPDSAS RNGSRALAEV LRQQGVQVEV VRTIRAFEAA RVDPSTTVVV GSFDYLGEAA       120
     AERTSRHSSS ARRLVLLEPG DLALGDLGVP LVTTGGGRAE LTGGCNSDIV EADDRLDATT       180
     TVYASADDDG PALPRGATGC FPEKQSGVAL VVLPASGAQP ETVVLGSADA LTNARVGDAS       240
     HAAVGLRSLG NSERLVWYVP GLSDLDVADA SGEHRSSDRG VPDWFDPGVL LLVIAFIAFA       300
     LARGRRLGRI VTEPLPVVVR AVETTEARGR LYRRAGDRGR AASSLRSGTR HRLAARLGLP       360
     TPTVGSDLVE AVARAAGRGT AEVRALLDGP APTNDRDLVL LAEQLAQLEE NVRRA            415
//

If you have problems or comments...

PBIL Back to PBIL home page