(data stored in SCRATCH zone)

EMBL: CP002343.PE229

CP002343.PE229       Location/Qualifiers
FT   CDS             complement(251918..252562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1140 hypothetical protein; SPTR:
FT                   Putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46791"
FT                   /db_xref="GOA:E6S6Q5"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q5"
FT                   /protein_id="ADU46791.1"
FT                   /translation="MHVWAVSVPVDPSAEEAREWVLRELSRPEYADERGLLQRLLDWVG
FT                   DLVDELLRHDPGALPGWVLPVVLALLAALLGVVLVTRLGREAGTPRGGAGGVLDEPHLD
FT                   AEAYRARARAAYAVGEVDDAATDWFRAIAASASERAVIDESPGRTAHEVSVALAALLPE
FT                   EAPALSRAADQFDAIRYGDAHVDEAVARSIADLDTRLAASRPFLRRTRVTP"
     MHVWAVSVPV DPSAEEAREW VLRELSRPEY ADERGLLQRL LDWVGDLVDE LLRHDPGALP        60
     GWVLPVVLAL LAALLGVVLV TRLGREAGTP RGGAGGVLDE PHLDAEAYRA RARAAYAVGE       120
     VDDAATDWFR AIAASASERA VIDESPGRTA HEVSVALAAL LPEEAPALSR AADQFDAIRY       180
     GDAHVDEAVA RSIADLDTRL AASRPFLRRT RVTP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page