(data stored in SCRATCH zone)

EMBL: CP002343.PE23

CP002343.PE23        Location/Qualifiers
FT   CDS             complement(24198..25412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0023"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: sro:Sros_4222 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Antibiotic transporter; PFAM:
FT                   Bacterial protein of unknown function (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46585"
FT                   /db_xref="GOA:E6SEI4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI4"
FT                   /protein_id="ADU46585.1"
FT                   /translation="MEREEAVEVPAGRGLGRLLASTSVSIAGQGMVLAAVPLLAARLTD
FT                   DPFQVSLTVAATYAAWLVVGLPAGALVDRWPRRRTMVVADLVRALIIGGLGLAVVAGVA
FT                   QIWLLILSVFLLGVASCFFDPAAQAAIPAVVGRDSKVLATANARIWSLDLMGRSLIGPP
FT                   AGAALFVVAAGLPFVANAATFILSAMFLAGLGSLQPATARDGRPRLLASVKEGIHYLAR
FT                   HRELRTLTIGMASFNFVYNTANATFVLFAMDQLGVSEQGFGLLLASAAVGGLVAGYVVP
FT                   KFKSKVSATNLYGVGLAVQGLGWLAVLAAPNPWVAAIAVAAVGGTSMAVTVLGAVARQR
FT                   LTPDLMLGRVSATTRVAGIGSGALGALTGGLVASQLYIDAALWAAFITACLISVTLWMS
FT                   KSAEH"
     MEREEAVEVP AGRGLGRLLA STSVSIAGQG MVLAAVPLLA ARLTDDPFQV SLTVAATYAA        60
     WLVVGLPAGA LVDRWPRRRT MVVADLVRAL IIGGLGLAVV AGVAQIWLLI LSVFLLGVAS       120
     CFFDPAAQAA IPAVVGRDSK VLATANARIW SLDLMGRSLI GPPAGAALFV VAAGLPFVAN       180
     AATFILSAMF LAGLGSLQPA TARDGRPRLL ASVKEGIHYL ARHRELRTLT IGMASFNFVY       240
     NTANATFVLF AMDQLGVSEQ GFGLLLASAA VGGLVAGYVV PKFKSKVSAT NLYGVGLAVQ       300
     GLGWLAVLAA PNPWVAAIAV AAVGGTSMAV TVLGAVARQR LTPDLMLGRV SATTRVAGIG       360
     SGALGALTGG LVASQLYIDA ALWAAFITAC LISVTLWMSK SAEH                        404
//

If you have problems or comments...

PBIL Back to PBIL home page