(data stored in SCRATCH zone)

EMBL: CP002343.PE231

CP002343.PE231       Location/Qualifiers
FT   CDS             complement(253738..254169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0236"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="COGs: COG2050 Uncharacterized protein possibly
FT                   involved in aromatic compounds catabolism; InterPro
FT                   IPR006683: IPR003736: IPR011973; KEGG: kfl:Kfla_6849
FT                   phenylacetic acid degradation protein PaaD; PFAM:
FT                   thioesterase superfamily protein; SPTR: Probable
FT                   phenylacetic acid degradation protein; TIGRFAM:
FT                   phenylacetic acid degradation protein PaaD; PFAM:
FT                   Thioesterase superfamily; TIGRFAM: uncharacterized domain
FT                   1; phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46793"
FT                   /db_xref="GOA:E6S6Q7"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q7"
FT                   /protein_id="ADU46793.1"
FT                   /translation="MSEPVGGGEDAGVAFARQMWADDEASRRLGMEAVVIEQDHAVVRM
FT                   PVRADMVNGHDICHGGFVFTLADSTFALACNSRGVVTVASGADITFTAPSRLGDVLVAE
FT                   GMVRSAFGRSGITDVTVKRESDGQIIAEFRGRSRSLKRQ"
     MSEPVGGGED AGVAFARQMW ADDEASRRLG MEAVVIEQDH AVVRMPVRAD MVNGHDICHG        60
     GFVFTLADST FALACNSRGV VTVASGADIT FTAPSRLGDV LVAEGMVRSA FGRSGITDVT       120
     VKRESDGQII AEFRGRSRSL KRQ                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page