(data stored in SCRATCH zone)

EMBL: CP002343.PE232

CP002343.PE232       Location/Qualifiers
FT   CDS             complement(254166..255341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0237"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /EC_number="1.1.1.157"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro IPR006176: IPR006108: IPR006180; KEGG:
FT                   kse:Ksed_01910 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   SPTR: 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46794"
FT                   /db_xref="GOA:E6S6Q8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q8"
FT                   /protein_id="ADU46794.1"
FT                   /translation="MNLTDVAVIGAGAMGAGIAQVAATAGHRVSLVDAVPGAAEAATDR
FT                   LGGGLDRLVAKGRLTADDAAAIRGRLTPAGSVAELPDCGLVIEAVPEDLALKRKIFGEL
FT                   GGSQPASTILATNTSSIDVSAIAEAVIHPERVVGLHFFNPPQVMALVEVIHGARSSATV
FT                   LDEAVELMRAWGKTPVRCSSTPGFIVNRVARPFYGEAQRMVEAGVADAATIDWILREKG
FT                   GFPMGPLELTDFIGQDVNLAVGTSVWEQTGRDERYAPTEFQRGLVEAGRLGRKTGQGVY
FT                   TYAADGVLVGGDPDLGLAERLVGGPVETDPLARTVAMLVNEAADLVGRGEATAADVDIA
FT                   MVLGTRYPRGPIEWGRSLGFAVVSRQIEELDRVFPGGRYRPSPALLDGTVQ"
     MNLTDVAVIG AGAMGAGIAQ VAATAGHRVS LVDAVPGAAE AATDRLGGGL DRLVAKGRLT        60
     ADDAAAIRGR LTPAGSVAEL PDCGLVIEAV PEDLALKRKI FGELGGSQPA STILATNTSS       120
     IDVSAIAEAV IHPERVVGLH FFNPPQVMAL VEVIHGARSS ATVLDEAVEL MRAWGKTPVR       180
     CSSTPGFIVN RVARPFYGEA QRMVEAGVAD AATIDWILRE KGGFPMGPLE LTDFIGQDVN       240
     LAVGTSVWEQ TGRDERYAPT EFQRGLVEAG RLGRKTGQGV YTYAADGVLV GGDPDLGLAE       300
     RLVGGPVETD PLARTVAMLV NEAADLVGRG EATAADVDIA MVLGTRYPRG PIEWGRSLGF       360
     AVVSRQIEEL DRVFPGGRYR PSPALLDGTV Q                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page