(data stored in ACNUC7421 zone)

EMBL: CP002343.PE233

CP002343.PE233       Location/Qualifiers
FT   CDS             255397..257121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0238"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590: IPR011975; KEGG: kse:Ksed_01930
FT                   phenylacetic acid degradation protein PaaN; PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: Phenylacetic acid degradation protein
FT                   paaN; TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM: phenylacetic
FT                   acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46795"
FT                   /db_xref="GOA:E6S6Q9"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q9"
FT                   /protein_id="ADU46795.1"
FT                   /translation="MTAQATKPTHPLLDQHAGVLDEIRQALAERSWFSRYPESPSPRVY
FT                   GETAAADGLAAYEAHLNRPYAAELASGVTGTFVGSEVSPYGPTLGVSYPALDLDAALAA
FT                   ARAAVPAWRDAGPQVRAAVCVEIVDAINRRSFEVANAVMHTSGQPFVMSFQAGGPHAQE
FT                   RALEAVAAGLVEQERVPASVVWEKPGKDREGKPAPIRMQKDYRIVPRGVSLVIGCNTFP
FT                   TWNAYPGIFASLVTGNPVVIKPHPRAVLPLAITVEAARGVLAAAGFDPALVQLAAEVDG
FT                   QGLARTLAERDEVAIIDYTGGPAFGGWLEERGAALGKLVYTEKAGLNTVVVDSTDDLKG
FT                   LLGNLAFSLTLYSGQMCTAPQNIYVPTGGVDTDEGHLSFDEFGERLGSAVSRLTGDDAK
FT                   AVELLGATVNDQVRANAESLEAMAAEAEGRVLLQSRRIAHPVYAEAVVRAPGLVAVDVQ
FT                   REDVYTQECFGPVGFLIQTASTEQSLAQLADTVKEHGGMTASVYSTSEEVLEGAREAAA
FT                   TGGVALSENLTGQIFVNQTAAFSDFHGTGANPAANAAYTDSAFVANRFRVITARRHI"
     MTAQATKPTH PLLDQHAGVL DEIRQALAER SWFSRYPESP SPRVYGETAA ADGLAAYEAH        60
     LNRPYAAELA SGVTGTFVGS EVSPYGPTLG VSYPALDLDA ALAAARAAVP AWRDAGPQVR       120
     AAVCVEIVDA INRRSFEVAN AVMHTSGQPF VMSFQAGGPH AQERALEAVA AGLVEQERVP       180
     ASVVWEKPGK DREGKPAPIR MQKDYRIVPR GVSLVIGCNT FPTWNAYPGI FASLVTGNPV       240
     VIKPHPRAVL PLAITVEAAR GVLAAAGFDP ALVQLAAEVD GQGLARTLAE RDEVAIIDYT       300
     GGPAFGGWLE ERGAALGKLV YTEKAGLNTV VVDSTDDLKG LLGNLAFSLT LYSGQMCTAP       360
     QNIYVPTGGV DTDEGHLSFD EFGERLGSAV SRLTGDDAKA VELLGATVND QVRANAESLE       420
     AMAAEAEGRV LLQSRRIAHP VYAEAVVRAP GLVAVDVQRE DVYTQECFGP VGFLIQTAST       480
     EQSLAQLADT VKEHGGMTAS VYSTSEEVLE GAREAAATGG VALSENLTGQ IFVNQTAAFS       540
     DFHGTGANPA ANAAYTDSAF VANRFRVITA RRHI                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page