(data stored in SCRATCH zone)

EMBL: CP002343.PE237

CP002343.PE237       Location/Qualifiers
FT   CDS             complement(262586..263782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0242"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="COGs: COG0420 DNA repair exonuclease; InterPro
FT                   IPR004843: IPR004593; KEGG: cmi:CMM_0677 putative dsDNA
FT                   exonuclease subunit; PFAM: metallophosphoesterase; SPTR:
FT                   Putative dsDNA exonuclease subunit; TIGRFAM: nuclease
FT                   SbcCD, D subunit; manually curated; PFAM: Calcineurin-like
FT                   phosphoesterase; Type 5 capsule protein repressor C
FT                   terminal; TIGRFAM: exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46799"
FT                   /db_xref="GOA:E6S6R3"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R3"
FT                   /protein_id="ADU46799.1"
FT                   /translation="MRMLHTSDWHLGRTLHGVSLHEAQAAVLERICELVEDPPDGVPVD
FT                   AVIVAGDVYDRGVPPVESVQLFEWTLSRLSQVTTVVVTSGNHDSAIRLGYGAGLFRDTI
FT                   RMITDLSMVDLPVLLDGSDGVRAAIYGIPYLDVDHARAALARGGELLPRSHQAVVGAAC
FT                   DRIREDLRARTGVRSVVVAHAFVAGAEPSDSERSIAVGGVDRVAGTVFAGLDYAALGHL
FT                   HGPQSPECAEGSVVRYSGSPLRYSFSEQDHAKCVLLVDLPAAGPVVVTPLPITQPRPMA
FT                   TLRGMLDDLLADPAHAMHEDAWLRVTLTDRVRPDSLMDRLKSRFPHVLQVFHEPDGRIE
FT                   RGVRGTTAVSERDPRELGSDFISYVTKTEASTGEIGCFVAGYEAAVKAQALAEAQEVA"
     MRMLHTSDWH LGRTLHGVSL HEAQAAVLER ICELVEDPPD GVPVDAVIVA GDVYDRGVPP        60
     VESVQLFEWT LSRLSQVTTV VVTSGNHDSA IRLGYGAGLF RDTIRMITDL SMVDLPVLLD       120
     GSDGVRAAIY GIPYLDVDHA RAALARGGEL LPRSHQAVVG AACDRIREDL RARTGVRSVV       180
     VAHAFVAGAE PSDSERSIAV GGVDRVAGTV FAGLDYAALG HLHGPQSPEC AEGSVVRYSG       240
     SPLRYSFSEQ DHAKCVLLVD LPAAGPVVVT PLPITQPRPM ATLRGMLDDL LADPAHAMHE       300
     DAWLRVTLTD RVRPDSLMDR LKSRFPHVLQ VFHEPDGRIE RGVRGTTAVS ERDPRELGSD       360
     FISYVTKTEA STGEIGCFVA GYEAAVKAQA LAEAQEVA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page