(data stored in ACNUC7421 zone)

EMBL: CP002343.PE240

CP002343.PE240       Location/Qualifiers
FT   CDS             complement(265109..265492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0245"
FT                   /product="membrane protein of unknown function"
FT                   /note="InterPro IPR007165; KEGG: kse:Ksed_02330 predicted
FT                   membrane protein; PFAM: membrane protein of unknown
FT                   function; SPTR: Predicted membrane protein; PFAM: Membrane
FT                   protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46802"
FT                   /db_xref="GOA:E6S6R6"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R6"
FT                   /protein_id="ADU46802.1"
FT                   /translation="MLLNFVIKTVINGIALWIAALLVDGITFGTQADTAAIVRTVLIVA
FT                   LIFGVLNTFVRPIAKAVSLPFIILTLGLFVFIINALMLQLTSWLADQLNLAFHVEHFFW
FT                   DAVLGSLIITFVSMILGFFNPKD"
     MLLNFVIKTV INGIALWIAA LLVDGITFGT QADTAAIVRT VLIVALIFGV LNTFVRPIAK        60
     AVSLPFIILT LGLFVFIINA LMLQLTSWLA DQLNLAFHVE HFFWDAVLGS LIITFVSMIL       120
     GFFNPKD                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page