(data stored in ACNUC7421 zone)

EMBL: CP002343.PE243

CP002343.PE243       Location/Qualifiers
FT   CDS             268074..269228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0248"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR001017: IPR017596; KEGG: nca:Noca_4509
FT                   pyruvate dehydrogenase (acetyl-transferring); PFAM:
FT                   dehydrogenase E1 component; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: Pyruvate dehydrogenase
FT                   (Acetyl-transferring); TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   Dehydrogenase E1 component; TIGRFAM: pyruvate dehydrogenase
FT                   E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46805"
FT                   /db_xref="GOA:E6S6R9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R9"
FT                   /protein_id="ADU46805.1"
FT                   /translation="MSDKVVAELHEPTPAVGDGGPDMIQLLTPEGERLSHPDYDKYVAD
FT                   LTPEDLRSFYRDLVLIRRLDAEGYALQRQGELGLWPSLLGQEAAQVGSGRALKPHDMCF
FT                   PTYREHGVGFVRGMDPQSSLQLFRGVSQGGWDPKDHNFHLYTIVIGAQTLHATGYAMGV
FT                   KMDGNVGTGDPDRDTAVICYFGDGASSQGDVNEAFVYAASFDAPVVFFCQNNQWAISEP
FT                   VSKQTRIPLFQRARGFGFPGMRVDGNDVLATYAVTQHCLDEARNGNGPLLIEAFTYRMG
FT                   AHTTADDPTKYRVSAEVEQWKFRDPILRLKTYLSHEGWADEAFFTRVDEEADQFAAELR
FT                   HGCITMDTMPGETMWDHVYAEDHPVMEAERAAFQAYQASFEEAN"
     MSDKVVAELH EPTPAVGDGG PDMIQLLTPE GERLSHPDYD KYVADLTPED LRSFYRDLVL        60
     IRRLDAEGYA LQRQGELGLW PSLLGQEAAQ VGSGRALKPH DMCFPTYREH GVGFVRGMDP       120
     QSSLQLFRGV SQGGWDPKDH NFHLYTIVIG AQTLHATGYA MGVKMDGNVG TGDPDRDTAV       180
     ICYFGDGASS QGDVNEAFVY AASFDAPVVF FCQNNQWAIS EPVSKQTRIP LFQRARGFGF       240
     PGMRVDGNDV LATYAVTQHC LDEARNGNGP LLIEAFTYRM GAHTTADDPT KYRVSAEVEQ       300
     WKFRDPILRL KTYLSHEGWA DEAFFTRVDE EADQFAAELR HGCITMDTMP GETMWDHVYA       360
     EDHPVMEAER AAFQAYQASF EEAN                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page