(data stored in SCRATCH zone)

EMBL: CP002343.PE249

CP002343.PE249       Location/Qualifiers
FT   CDS             276540..277997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_1105 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46811"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S5"
FT                   /protein_id="ADU46811.1"
FT                   /translation="MAEHRGVVFPLDEASGRRSTAAVGRAVVADALLSVDPVGAASAAR
FT                   ETNWRQGYLEHFRRLVEAGLPGAAAAHTIAREGLISVHARMRWTGPSGEVALAAAVEEP
FT                   VTRLGSATIRGEGAPDRTISLPYAAERASGDRLRRVLAGWVERGVVEPSCAEAVELVIA
FT                   NPDWLDLSDQTIVVLGAAAEMGPLRSLLRWGADVVAVDLPRKDLWHRLIGDTRRLSGSM
FT                   TVPVQPGSGPVESRLGGDLVHDLASVTQWVTSQEGPLVLGNYVYADGATNVRVATAVDV
FT                   LTQRAVAERGRDEVSLAFLATPTDVFAVPGGAVARSVENYAQRHTSKVLRVPLRTLSGG
FT                   RLMRRNYVPGEDPGINDSVVLQQGPNYLLAKRLQRWRATAHRADGGLVSLNVAPPTRTR
FT                   SVVKNRALAAAYAGAHRFGVEVFEPGTANTLMAILLVHDLRVGAPAREHPWQDEAAAAV
FT                   HGGLWTSAYDPRSVLGIAALLGLAAAR"
     MAEHRGVVFP LDEASGRRST AAVGRAVVAD ALLSVDPVGA ASAARETNWR QGYLEHFRRL        60
     VEAGLPGAAA AHTIAREGLI SVHARMRWTG PSGEVALAAA VEEPVTRLGS ATIRGEGAPD       120
     RTISLPYAAE RASGDRLRRV LAGWVERGVV EPSCAEAVEL VIANPDWLDL SDQTIVVLGA       180
     AAEMGPLRSL LRWGADVVAV DLPRKDLWHR LIGDTRRLSG SMTVPVQPGS GPVESRLGGD       240
     LVHDLASVTQ WVTSQEGPLV LGNYVYADGA TNVRVATAVD VLTQRAVAER GRDEVSLAFL       300
     ATPTDVFAVP GGAVARSVEN YAQRHTSKVL RVPLRTLSGG RLMRRNYVPG EDPGINDSVV       360
     LQQGPNYLLA KRLQRWRATA HRADGGLVSL NVAPPTRTRS VVKNRALAAA YAGAHRFGVE       420
     VFEPGTANTL MAILLVHDLR VGAPAREHPW QDEAAAAVHG GLWTSAYDPR SVLGIAALLG       480
     LAAAR                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page