(data stored in ACNUC7421 zone)

EMBL: CP002343.PE25

CP002343.PE25        Location/Qualifiers
FT   CDS             complement(25664..26587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0025"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: fre:Franean1_0907
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: DNA-binding protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46587"
FT                   /db_xref="GOA:E6SEI6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI6"
FT                   /protein_id="ADU46587.1"
FT                   /translation="MTVQTDPLRGSQRLSSRFPVLAGYIVVLFITAWKDAMIEVGAELR
FT                   RIREAAGISGSAVARDLGWSQSKISRVETGRFGASVSEVAELLNYYGVAEEVRAEILGS
FT                   VARSSGLEGAWIVSAGGAPRRQAAVEAVETRVKRLRQYQASWIPGLLQTEAYTRGICEA
FT                   AGLNAEAVVGQRLERQRLLGERHGVRYDVVLDEAVLRRSPRTTGADMTSQLERLLERIE
FT                   EGYADLRVVPLGSTNATYVAGSFVLYEFKAGTPVVLVEAQTADLYLSAERDITAYERLF
FT                   EQLRKDALDVDESRRAIESARRDWAS"
     MTVQTDPLRG SQRLSSRFPV LAGYIVVLFI TAWKDAMIEV GAELRRIREA AGISGSAVAR        60
     DLGWSQSKIS RVETGRFGAS VSEVAELLNY YGVAEEVRAE ILGSVARSSG LEGAWIVSAG       120
     GAPRRQAAVE AVETRVKRLR QYQASWIPGL LQTEAYTRGI CEAAGLNAEA VVGQRLERQR       180
     LLGERHGVRY DVVLDEAVLR RSPRTTGADM TSQLERLLER IEEGYADLRV VPLGSTNATY       240
     VAGSFVLYEF KAGTPVVLVE AQTADLYLSA ERDITAYERL FEQLRKDALD VDESRRAIES       300
     ARRDWAS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page