(data stored in ACNUC7421 zone)

EMBL: CP002343.PE250

CP002343.PE250       Location/Qualifiers
FT   CDS             278024..279340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0256"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: aau:AAur_pTC10168
FT                   H(+)-stimulated manganese uptake protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: Mn2+/Fe2+
FT                   transporter, NRAMP family; PFAM: Natural
FT                   resistance-associated macrophage protein; TIGRFAM: NRAMP
FT                   (natural resistance-associated macrophage protein) metal
FT                   ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46812"
FT                   /db_xref="GOA:E6S6S6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S6"
FT                   /protein_id="ADU46812.1"
FT                   /translation="MWLSELARRVPVAHALTMGDRPGRALPSHVDARSPEHGLGGTLRA
FT                   PRTLVPALLAAIAYVDPGNFGVNITSGAEHGYALVWVVVFASCAAMVIQYLAAKLGMVT
FT                   GLSLAEHSARRYPGVGRIVLWTQAEIVVIMTDLAEIVGGAIALYLLFGMPLMWGAVAVT
FT                   GFSLVVLYLKVHGRSHFESVVLVLLAVIIGSLLWQVLVAEVDRVALLRSAVPGPLDSSA
FT                   ALLAVGIVGATVMPHALHFHSAASRTRDDGQVEPSQAVRLRIGRQTVRSVVIAMTVAGA
FT                   ANISLVVFAAALPSEAGASIETAYAALGAEAGQIAATMLAVALLASGLASTLVGVQTGD
FT                   VVMTGFGRRPIPALLRRTLAVVPALIILGLGVEPTLALVWSQVILSFALPGTLIPLLLF
FT                   THDRRLMGAMANHRLTTAVAWIITAVIVGLVGFLLVSGA"
     MWLSELARRV PVAHALTMGD RPGRALPSHV DARSPEHGLG GTLRAPRTLV PALLAAIAYV        60
     DPGNFGVNIT SGAEHGYALV WVVVFASCAA MVIQYLAAKL GMVTGLSLAE HSARRYPGVG       120
     RIVLWTQAEI VVIMTDLAEI VGGAIALYLL FGMPLMWGAV AVTGFSLVVL YLKVHGRSHF       180
     ESVVLVLLAV IIGSLLWQVL VAEVDRVALL RSAVPGPLDS SAALLAVGIV GATVMPHALH       240
     FHSAASRTRD DGQVEPSQAV RLRIGRQTVR SVVIAMTVAG AANISLVVFA AALPSEAGAS       300
     IETAYAALGA EAGQIAATML AVALLASGLA STLVGVQTGD VVMTGFGRRP IPALLRRTLA       360
     VVPALIILGL GVEPTLALVW SQVILSFALP GTLIPLLLFT HDRRLMGAMA NHRLTTAVAW       420
     IITAVIVGLV GFLLVSGA                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page