(data stored in ACNUC7421 zone)

EMBL: CP002343.PE251

CP002343.PE251       Location/Qualifiers
FT   CDS             279602..280762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0257"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006092: IPR006091: IPR006090: IPR006089; KEGG:
FT                   mgi:Mflv_5166 Fis family transcriptional regulator; PFAM:
FT                   acyl-CoA dehydrogenase domain-containing protein; SPTR:
FT                   Transcriptional regulator, Fis family; PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46813"
FT                   /db_xref="GOA:E6S6S7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S7"
FT                   /protein_id="ADU46813.1"
FT                   /translation="MAREPRAPIVPPVVVEGEVLRGLRLEVREFLAGQIESGRFTPHVD
FT                   TWLTRWDRDFTRELGRRGWLGMVIPEEYGGQGRTYLERFVVTEELLVVGAPVAAHWVAE
FT                   RQIGPSLLRFGTEEQKRHFLPRISRGDLVFGIGMSEPDSGSDLASVRTRAQQVDGGWRL
FT                   TGTKVWTSGAHEADAFFALARSAPLDPAHRHQGLSQFIVDLRAPGVEIRPIISMGGDHH
FT                   FNEVHLDGVLVPDDRVLGTIGEGWQQVTSELGFERSGPERYLSTFQLLAAAAEAMEAGV
FT                   LPLDPGLGRHVARVAALHQMSFAVSTALEAHADADTAAAAVKVLGTTTEGDIADYVDTL
FT                   TATGWIEDEELHTLLHAAILQRPGFTLRGGTNEILRGVIARGLGMR"
     MAREPRAPIV PPVVVEGEVL RGLRLEVREF LAGQIESGRF TPHVDTWLTR WDRDFTRELG        60
     RRGWLGMVIP EEYGGQGRTY LERFVVTEEL LVVGAPVAAH WVAERQIGPS LLRFGTEEQK       120
     RHFLPRISRG DLVFGIGMSE PDSGSDLASV RTRAQQVDGG WRLTGTKVWT SGAHEADAFF       180
     ALARSAPLDP AHRHQGLSQF IVDLRAPGVE IRPIISMGGD HHFNEVHLDG VLVPDDRVLG       240
     TIGEGWQQVT SELGFERSGP ERYLSTFQLL AAAAEAMEAG VLPLDPGLGR HVARVAALHQ       300
     MSFAVSTALE AHADADTAAA AVKVLGTTTE GDIADYVDTL TATGWIEDEE LHTLLHAAIL       360
     QRPGFTLRGG TNEILRGVIA RGLGMR                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page