(data stored in ACNUC7421 zone)

EMBL: CP002343.PE252

CP002343.PE252       Location/Qualifiers
FT   CDS             280762..281820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0258"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006090; KEGG: mgi:Mflv_5167 acyl-CoA dehydrogenase
FT                   domain-containing protein; PFAM: acyl-CoA dehydrogenase
FT                   domain-containing protein; SPTR: Acyl-CoA dehydrogenase
FT                   domain protein; PFAM: Acyl-CoA dehydrogenase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46814"
FT                   /db_xref="GOA:E6S6S8"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S8"
FT                   /protein_id="ADU46814.1"
FT                   /translation="MAELEHLARSTSADPDLVAMLTDLFATYRSTRPAPTELLDLDLGL
FT                   WAQLDELGLTRLTASEASGGSGASWVEGSALLGLAAAAGAPVPLVEHGMLGAWLLEEAG
FT                   LPNDGALRTVCRPDPSGRALNVTFARDSASIVALWEDADRWRVADVPTERVGLTQSRNL
FT                   AGEPCDTVEFELVDLASAPFVDDSVGHQFHLRGALARSAQVCGAMERVLEVVLTHTRER
FT                   EQFGRPIGRFQAVQHLVADIATESSLARAATDTAVARAAASQWQDPGMLFAVGVAKSCV
FT                   GHAASVVVRNAHQVLGAIGTTLEHELHVLTKPILVRRSEYGSVHEWDETLAELAASAGR
FT                   DRLWPLILTGRR"
     MAELEHLARS TSADPDLVAM LTDLFATYRS TRPAPTELLD LDLGLWAQLD ELGLTRLTAS        60
     EASGGSGASW VEGSALLGLA AAAGAPVPLV EHGMLGAWLL EEAGLPNDGA LRTVCRPDPS       120
     GRALNVTFAR DSASIVALWE DADRWRVADV PTERVGLTQS RNLAGEPCDT VEFELVDLAS       180
     APFVDDSVGH QFHLRGALAR SAQVCGAMER VLEVVLTHTR EREQFGRPIG RFQAVQHLVA       240
     DIATESSLAR AATDTAVARA AASQWQDPGM LFAVGVAKSC VGHAASVVVR NAHQVLGAIG       300
     TTLEHELHVL TKPILVRRSE YGSVHEWDET LAELAASAGR DRLWPLILTG RR               352
//

If you have problems or comments...

PBIL Back to PBIL home page