(data stored in ACNUC7421 zone)

EMBL: CP002343.PE254

CP002343.PE254       Location/Qualifiers
FT   CDS             282729..283928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0260"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: sma:SAV_2408 transmembrane
FT                   efflux protein; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: Putative transmembrane efflux protein; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46816"
FT                   /db_xref="GOA:E6S6T0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T0"
FT                   /protein_id="ADU46816.1"
FT                   /translation="MLSSYRPLFEVPGARTFIIGGMTARSAGAMFAVATVAMVAARRGS
FT                   YELAGAVMAAGLVALAVAAPVLGRLVDRYGQSRVAVPFFIWSGFWAAMTMVASWRGWPS
FT                   WVLFITFPLCAVIPNLGTMARARWSHIFAHDPRSLHTAMSFEQVMEEVTFVIGPVLAIW
FT                   LSTTLFPEAGFLFAAICYAVGVLVFVSARSTEPPIVPHHERPGGGAHRHPGILPLAFIM
FT                   VMTGAIFGVNEVVTLAVAEDAGHPNVAGAVLGLFAVGSAASGLVFGQISHGRNLLKLLL
FT                   VGTLGMMVLEAPVLLAGNLWVLAGIMLVAGMATAPTLITTMNLIERIVPRAQINEGMTL
FT                   VLTGLIIGIAAGSAVSGAVIDRVGPRHGYWVAVVAGGAAFLMALATRRFLSRRDMHNLR
FT                   "
     MLSSYRPLFE VPGARTFIIG GMTARSAGAM FAVATVAMVA ARRGSYELAG AVMAAGLVAL        60
     AVAAPVLGRL VDRYGQSRVA VPFFIWSGFW AAMTMVASWR GWPSWVLFIT FPLCAVIPNL       120
     GTMARARWSH IFAHDPRSLH TAMSFEQVME EVTFVIGPVL AIWLSTTLFP EAGFLFAAIC       180
     YAVGVLVFVS ARSTEPPIVP HHERPGGGAH RHPGILPLAF IMVMTGAIFG VNEVVTLAVA       240
     EDAGHPNVAG AVLGLFAVGS AASGLVFGQI SHGRNLLKLL LVGTLGMMVL EAPVLLAGNL       300
     WVLAGIMLVA GMATAPTLIT TMNLIERIVP RAQINEGMTL VLTGLIIGIA AGSAVSGAVI       360
     DRVGPRHGYW VAVVAGGAAF LMALATRRFL SRRDMHNLR                              399
//

If you have problems or comments...

PBIL Back to PBIL home page