(data stored in ACNUC7421 zone)

EMBL: CP002343.PE256

CP002343.PE256       Location/Qualifiers
FT   CDS             complement(284973..285842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0262"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR017517; KEGG: tcu:Tcur_3849 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Mycothiol maleylpyruvate isomerase N-terminal domain;
FT                   TIGRFAM: uncharacterized Actinobacterial protein TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46818"
FT                   /db_xref="GOA:E6S6T2"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T2"
FT                   /protein_id="ADU46818.1"
FT                   /translation="MPLHPAAPDDQGGLLDAFEQVVQAIVDLGWACREEDFEKPTECPG
FT                   WTVKDHMVKVVATEKAFAALPREPHGPANRAEVRNEFNRMVDLEVAARRQWTGRSVISE
FT                   LADFHQHRMSQLRSLDVDLDTEIAGFFRERTTFGDQLRAQITETWVHEQDVRTALDRPG
FT                   NLDSPAAAVFTAAIVDALPLVAVRDAGIEPGSAVVLDVTGPVLARGGARVVEGPDGRPV
FT                   GEALFSGQDPEAGEPLDVTTIQLTTEALTRRAAGRRTRDEIHFTILGDESVGHRILDAL
FT                   DVLGPAAS"
     MPLHPAAPDD QGGLLDAFEQ VVQAIVDLGW ACREEDFEKP TECPGWTVKD HMVKVVATEK        60
     AFAALPREPH GPANRAEVRN EFNRMVDLEV AARRQWTGRS VISELADFHQ HRMSQLRSLD       120
     VDLDTEIAGF FRERTTFGDQ LRAQITETWV HEQDVRTALD RPGNLDSPAA AVFTAAIVDA       180
     LPLVAVRDAG IEPGSAVVLD VTGPVLARGG ARVVEGPDGR PVGEALFSGQ DPEAGEPLDV       240
     TTIQLTTEAL TRRAAGRRTR DEIHFTILGD ESVGHRILDA LDVLGPAAS                   289
//

If you have problems or comments...

PBIL Back to PBIL home page