(data stored in SCRATCH zone)

EMBL: CP002343.PE260

CP002343.PE260       Location/Qualifiers
FT   CDS             289158..291032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0266"
FT                   /product="NHL repeat containing protein"
FT                   /note="InterPro IPR000866: IPR001258: IPR017936; KEGG:
FT                   ach:Achl_3716 NHL repeat containing protein; PFAM: NHL
FT                   repeat containing protein; alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; SPTR: NHL repeat
FT                   containing protein; PFAM: NHL repeat; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46822"
FT                   /db_xref="GOA:E6S6T6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T6"
FT                   /protein_id="ADU46822.1"
FT                   /translation="MTTEPSLRARVKVRAPELVGRGWLNTGGRALSLADFRGRVLVLDF
FT                   WTFCCVNCLHVLDELRPVEAQYPDALTIVGVHSPKFEHEADPDALAAAVERYAVHHPVL
FT                   DDPELVTWRAYTARAWPTLVVVDPEGYVVASMSGEGHGPGLAALVGELIEEHAAKGTLQ
FT                   PGGDPFVPPPAPDTALRFPGKVVALDDGSFVVSDTANHQVVHLEADLETERRRWGGPGV
FT                   LNEPQGLVLATSKVRDQYGVDLVVADSVNHQVKGIRFSDGTIHPLVGTGRQLRQRRGGA
FT                   PARQQDLSTPWDLAWLDGRLIIAMAGTHQLWAWSPAGPPETAPTPGGTVEVIAGTTNEG
FT                   LRDGPGAQAWFAQPSGLCTSADGRRVWVADSETSALRSVAIDDTGGLTVQTHVGTGLFD
FT                   FGHRDGPAAQALLQHPLGVTELPDGSVAVSDTYNGAIRRYDPVTGEVTTLARDLAEPSD
FT                   AVVEGDPESGRTRLVVVESAAHRLTRIALPEDAQRVDGPARRTQRPATELAPGEVRLEV
FT                   TFVPPKGQKLDDRWGDPTVLDVSASPEGLLLDGGGRTRGLRRTLTLASGIRTGTLHVSV
FT                   QAAACDGDPETDDLPEHAACHLFQQDWGIPLTLVADGPTELTLDLRGA"
     MTTEPSLRAR VKVRAPELVG RGWLNTGGRA LSLADFRGRV LVLDFWTFCC VNCLHVLDEL        60
     RPVEAQYPDA LTIVGVHSPK FEHEADPDAL AAAVERYAVH HPVLDDPELV TWRAYTARAW       120
     PTLVVVDPEG YVVASMSGEG HGPGLAALVG ELIEEHAAKG TLQPGGDPFV PPPAPDTALR       180
     FPGKVVALDD GSFVVSDTAN HQVVHLEADL ETERRRWGGP GVLNEPQGLV LATSKVRDQY       240
     GVDLVVADSV NHQVKGIRFS DGTIHPLVGT GRQLRQRRGG APARQQDLST PWDLAWLDGR       300
     LIIAMAGTHQ LWAWSPAGPP ETAPTPGGTV EVIAGTTNEG LRDGPGAQAW FAQPSGLCTS       360
     ADGRRVWVAD SETSALRSVA IDDTGGLTVQ THVGTGLFDF GHRDGPAAQA LLQHPLGVTE       420
     LPDGSVAVSD TYNGAIRRYD PVTGEVTTLA RDLAEPSDAV VEGDPESGRT RLVVVESAAH       480
     RLTRIALPED AQRVDGPARR TQRPATELAP GEVRLEVTFV PPKGQKLDDR WGDPTVLDVS       540
     ASPEGLLLDG GGRTRGLRRT LTLASGIRTG TLHVSVQAAA CDGDPETDDL PEHAACHLFQ       600
     QDWGIPLTLV ADGPTELTLD LRGA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page