(data stored in SCRATCH zone)

EMBL: CP002343.PE266

CP002343.PE266       Location/Qualifiers
FT   CDS             complement(296878..297513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0272"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="COGs: COG2085 dinucleotide-binding protein; InterPro
FT                   IPR004455; KEGG: rxy:Rxyl_1793 reduced coenzyme F420:NADP
FT                   oxidoreductase; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; SPTR: Putative reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46828"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U2"
FT                   /protein_id="ADU46828.1"
FT                   /translation="MHVAIIGSGNVGGALAGAAIAAGHSVTLSAADAAHAAEVAGRTGA
FT                   TAAATNAEAVRDADVVVLAIPGLAVPAVADELRDALQGKVVIDATNPLNESFTDTFTTD
FT                   RSAAEELQERVPGVPVIKAFNTIFASRHGNPSEGGQPLDAYIAGDDAAAKAKAAELAGS
FT                   LGYRVIDAGSLRMARALEEMAFLNISLNAGNGWTWQSGWKLVGPTEAQ"
     MHVAIIGSGN VGGALAGAAI AAGHSVTLSA ADAAHAAEVA GRTGATAAAT NAEAVRDADV        60
     VVLAIPGLAV PAVADELRDA LQGKVVIDAT NPLNESFTDT FTTDRSAAEE LQERVPGVPV       120
     IKAFNTIFAS RHGNPSEGGQ PLDAYIAGDD AAAKAKAAEL AGSLGYRVID AGSLRMARAL       180
     EEMAFLNISL NAGNGWTWQS GWKLVGPTEA Q                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page