(data stored in ACNUC7421 zone)

EMBL: CP002343.PE267

CP002343.PE267       Location/Qualifiers
FT   CDS             297602..298054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0273"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835; KEGG: scb:SCAB_86641 putative MarR family
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; SPTR: Transcriptional regulator; PFAM: MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46829"
FT                   /db_xref="GOA:E6S6U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U3"
FT                   /protein_id="ADU46829.1"
FT                   /translation="MTTTTTDHDLVSTFGLLMEAYNSLEKQLGDSLEREAGVPHTWFEV
FT                   MLRISRADAGLAPMGCLAEQVALTGGGVTRMVDRMVAAGLIERVPCAQDRRVVYAALTT
FT                   QGQQVLTKAVAVHEGNLQRILSDFAPGELDTLDETLRRLRTARLPD"
     MTTTTTDHDL VSTFGLLMEA YNSLEKQLGD SLEREAGVPH TWFEVMLRIS RADAGLAPMG        60
     CLAEQVALTG GGVTRMVDRM VAAGLIERVP CAQDRRVVYA ALTTQGQQVL TKAVAVHEGN       120
     LQRILSDFAP GELDTLDETL RRLRTARLPD                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page