(data stored in ACNUC7421 zone)

EMBL: CP002343.PE268

CP002343.PE268       Location/Qualifiers
FT   CDS             complement(298230..299129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_0348 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46830"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U4"
FT                   /protein_id="ADU46830.1"
FT                   /translation="MTHPTWRGVTICPCLKEPLDELARASGKDILVSPIKGFGSYQVGR
FT                   TASAGTGSGGGHVDLALRGLTPEQKLRLEGLARRIGFYADIREPTWWSPTRRQWLSEKW
FT                   SSHLHMLLKDCRHLSPEARTQLRDWYSGGNGLVGSDPDDGDRTHLRQTWKQYRSDRQGV
FT                   RPPAPQATIAVANLKHGRRNGDVKRYQAAVWRRLAAATRARILAANHLKETQIADGFFG
FT                   DVTVEMTTALYRQIAAREPQGGWPIWAEPGPRLLKRLGFIPAGARDLDDPHDEFGEPDS
FT                   VSDPVSANIDPHPAGVVQ"
     MTHPTWRGVT ICPCLKEPLD ELARASGKDI LVSPIKGFGS YQVGRTASAG TGSGGGHVDL        60
     ALRGLTPEQK LRLEGLARRI GFYADIREPT WWSPTRRQWL SEKWSSHLHM LLKDCRHLSP       120
     EARTQLRDWY SGGNGLVGSD PDDGDRTHLR QTWKQYRSDR QGVRPPAPQA TIAVANLKHG       180
     RRNGDVKRYQ AAVWRRLAAA TRARILAANH LKETQIADGF FGDVTVEMTT ALYRQIAARE       240
     PQGGWPIWAE PGPRLLKRLG FIPAGARDLD DPHDEFGEPD SVSDPVSANI DPHPAGVVQ        299
//

If you have problems or comments...

PBIL Back to PBIL home page