(data stored in ACNUC7421 zone)

EMBL: CP002343.PE270

CP002343.PE270       Location/Qualifiers
FT   CDS             complement(301445..301999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2257 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46832"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U6"
FT                   /protein_id="ADU46832.1"
FT                   /translation="MQPATKVLSITGKGPFGMFGPDLFGDEKARALDYPVLATSEPGAG
FT                   LEASWAAYDPSEIWTLTNLGSLCADRGAATQAVARGKGWDWVFGGGTARYAAPTVVDPP
FT                   DREPYHAVQPVDTGLDGTFAQVIRRSDIAIADHECPVVADEDWSPQLGRALVFSVPEAV
FT                   LPQPWEGRVPVPEITLFQGSP"
     MQPATKVLSI TGKGPFGMFG PDLFGDEKAR ALDYPVLATS EPGAGLEASW AAYDPSEIWT        60
     LTNLGSLCAD RGAATQAVAR GKGWDWVFGG GTARYAAPTV VDPPDREPYH AVQPVDTGLD       120
     GTFAQVIRRS DIAIADHECP VVADEDWSPQ LGRALVFSVP EAVLPQPWEG RVPVPEITLF       180
     QGSP                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page