(data stored in ACNUC7421 zone)

EMBL: CP002343.PE272

CP002343.PE272       Location/Qualifiers
FT   CDS             302828..303175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0278"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: afo:Afer_0034 protein of unknown
FT                   function DUF86; PFAM: protein of unknown function DUF86;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46834"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U8"
FT                   /protein_id="ADU46834.1"
FT                   /translation="MLYEPFGLDRLYDIADAIAAIRSHVAQGTLSEAVVFDAVRMRLLE
FT                   IGEAVKGLSEELTAREPAIPWRTIARSRDNLAHHYFATELQIVEDTIKADLAPLDEAVA
FT                   RLIAEVERPRG"
     MLYEPFGLDR LYDIADAIAA IRSHVAQGTL SEAVVFDAVR MRLLEIGEAV KGLSEELTAR        60
     EPAIPWRTIA RSRDNLAHHY FATELQIVED TIKADLAPLD EAVARLIAEV ERPRG            115
//

If you have problems or comments...

PBIL Back to PBIL home page