(data stored in ACNUC7421 zone)

EMBL: CP002343.PE273

CP002343.PE273       Location/Qualifiers
FT   CDS             303459..303890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecx:EcHS_A2423 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46835"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U9"
FT                   /protein_id="ADU46835.1"
FT                   /translation="MDLVKQDALITHVRERGGHETQVAVTLEQFFDGNDCEWCIAPNRS
FT                   EDLTLGDVRRALVELRGHPDVHDVLVELDQLEFGTYPDDEWPYASGAAVITTLMPDEVD
FT                   ALLLEVEVDPSGGPASSLDWLVDAPAIPAGHHYVGVWWS"
     MDLVKQDALI THVRERGGHE TQVAVTLEQF FDGNDCEWCI APNRSEDLTL GDVRRALVEL        60
     RGHPDVHDVL VELDQLEFGT YPDDEWPYAS GAAVITTLMP DEVDALLLEV EVDPSGGPAS       120
     SLDWLVDAPA IPAGHHYVGV WWS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page