(data stored in ACNUC7421 zone)

EMBL: CP002343.PE275

CP002343.PE275       Location/Qualifiers
FT   CDS             305532..306233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0282"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="InterPro IPR000073; KEGG: sco:SCO0635 hypothetical
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Putative
FT                   uncharacterized protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46837"
FT                   /db_xref="GOA:E6S6V1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V1"
FT                   /protein_id="ADU46837.1"
FT                   /translation="MPLASLAWDARPARAGAVALVLHGGAVDGREPNHPWSHNVARLVP
FT                   FARALRKVPGPLAVARLRFRYRGWNGAEASPVEDARWALAQIRADYPDAPVALVGHSMG
FT                   GRTALTVADEDNVRLVVGLSPWIERGDPVPRDGRKTVLIHGDRDIITPLSASRRIVEGL
FT                   LDDGRDATLIRVARGDHAMLVRAGLWSTLVVDIVGSTFARELGGWSEPRSGPIGAVVAR
FT                   AVHGSGGILDI"
     MPLASLAWDA RPARAGAVAL VLHGGAVDGR EPNHPWSHNV ARLVPFARAL RKVPGPLAVA        60
     RLRFRYRGWN GAEASPVEDA RWALAQIRAD YPDAPVALVG HSMGGRTALT VADEDNVRLV       120
     VGLSPWIERG DPVPRDGRKT VLIHGDRDII TPLSASRRIV EGLLDDGRDA TLIRVARGDH       180
     AMLVRAGLWS TLVVDIVGST FARELGGWSE PRSGPIGAVV ARAVHGSGGI LDI              233
//

If you have problems or comments...

PBIL Back to PBIL home page