(data stored in ACNUC7421 zone)

EMBL: CP002343.PE276

CP002343.PE276       Location/Qualifiers
FT   CDS             306393..307511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0283"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1125 ABC-type proline/glycine betaine
FT                   transport systems ATPase components; InterPro IPR003439:
FT                   IPR003593: IPR017871; KEGG: kse:Ksed_26260 glycine
FT                   betaine/L-proline transport ATP binding subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: Putative ABC
FT                   transporter ATP-binding subunit; PFAM: ABC transporter;
FT                   TIGRFAM: glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46838"
FT                   /db_xref="GOA:E6S6V2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V2"
FT                   /protein_id="ADU46838.1"
FT                   /translation="MIRFERVTKTYGAGTAGATTAVDDLTLEAPTGRITVLVGPSGCGK
FT                   TTTLRMVNRMITPTSGTITIDGRDTAALDVAELRRNIGYVIQHAGLFPHRTVVDNVATV
FT                   PRLLGVDRRTARARAMELIERVGLDPSLARRYPAQLSGGQQQRVGVARALAADPPVMLM
FT                   DEPFSAVDPVVREQLQNEFLRLQSDLGKTILFVTHDIDEAIKLGDQVAVLRVGGVLAQL
FT                   DTPARLLADPVDDFVAEFVGRDRGYRALAFEDAPELALTTEPTTRLGAPGDEVRAIGQP
FT                   WVLALGADGDPVGWVRADAVTTTVDATLLHRGGTVARSDGSLRALLDAALSSPSGRGVV
FT                   ADRDGRFLGTILASQVVPAIEARREHKEVPAS"
     MIRFERVTKT YGAGTAGATT AVDDLTLEAP TGRITVLVGP SGCGKTTTLR MVNRMITPTS        60
     GTITIDGRDT AALDVAELRR NIGYVIQHAG LFPHRTVVDN VATVPRLLGV DRRTARARAM       120
     ELIERVGLDP SLARRYPAQL SGGQQQRVGV ARALAADPPV MLMDEPFSAV DPVVREQLQN       180
     EFLRLQSDLG KTILFVTHDI DEAIKLGDQV AVLRVGGVLA QLDTPARLLA DPVDDFVAEF       240
     VGRDRGYRAL AFEDAPELAL TTEPTTRLGA PGDEVRAIGQ PWVLALGADG DPVGWVRADA       300
     VTTTVDATLL HRGGTVARSD GSLRALLDAA LSSPSGRGVV ADRDGRFLGT ILASQVVPAI       360
     EARREHKEVP AS                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page