(data stored in SCRATCH zone)

EMBL: CP002343.PE279

CP002343.PE279       Location/Qualifiers
FT   CDS             308940..309863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0286"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG1732 Periplasmic glycine
FT                   betaine/choline-binding (lipo)protein of an ABC-type
FT                   transport system (osmoprotectant binding protein); InterPro
FT                   IPR007210; KEGG: nml:Namu_1403 substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: ABC-type glycine betaine transport,
FT                   substrate-binding protein; PFAM: Substrate binding domain
FT                   of ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46841"
FT                   /db_xref="GOA:E6S6V5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V5"
FT                   /protein_id="ADU46841.1"
FT                   /translation="MPRTRTLLAGLLAAAVLPLAACGSAEDPLAPSQPAGTNAGTGGAS
FT                   SVTIGSADFPESALLGEIYAQALEAKGVTVQRQFNIGNRETYLKAIEGGEVDILPEYTG
FT                   SLTNYFDKTVTATNPDEVYDALKSKLPGGLTVLAKSTAEDKNSMVVTKETADAWSLKAI
FT                   PDLVAHQDELSIAAPPEFRTRQQGLVGLKEVYNLEPKEFRPLASQATVEALKNGQVKAA
FT                   NIFSTDPSIAANGFVVLEDPELLFGSDNVVPLVRDDVAGSVQAPLDAVSAKLDTTALAD
FT                   MVKQVVVDKKDASVVAKEWLTGAGLI"
     MPRTRTLLAG LLAAAVLPLA ACGSAEDPLA PSQPAGTNAG TGGASSVTIG SADFPESALL        60
     GEIYAQALEA KGVTVQRQFN IGNRETYLKA IEGGEVDILP EYTGSLTNYF DKTVTATNPD       120
     EVYDALKSKL PGGLTVLAKS TAEDKNSMVV TKETADAWSL KAIPDLVAHQ DELSIAAPPE       180
     FRTRQQGLVG LKEVYNLEPK EFRPLASQAT VEALKNGQVK AANIFSTDPS IAANGFVVLE       240
     DPELLFGSDN VVPLVRDDVA GSVQAPLDAV SAKLDTTALA DMVKQVVVDK KDASVVAKEW       300
     LTGAGLI                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page