(data stored in ACNUC7421 zone)

EMBL: CP002343.PE28

CP002343.PE28        Location/Qualifiers
FT   CDS             complement(28368..28982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1188 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46590"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI9"
FT                   /protein_id="ADU46590.1"
FT                   /translation="MSDNLNRALRWPLWSWRNLAITVVSLFVAIALIGRVSSALGGDGE
FT                   APIKAASTAVPEGTQSPPAVTPSTGPLVSPAQTPTADLAAGPGTDCLSNAAQFVDEWMQ
FT                   TKRSQQLWLARMAPYATPAFLEELRSVDPANVPATTVEGEPQLVGQDGDLPIARITTDG
FT                   GRLDLVLARSGSTCVVSDIRSSDDVPGAPTPVLTATPKAGG"
     MSDNLNRALR WPLWSWRNLA ITVVSLFVAI ALIGRVSSAL GGDGEAPIKA ASTAVPEGTQ        60
     SPPAVTPSTG PLVSPAQTPT ADLAAGPGTD CLSNAAQFVD EWMQTKRSQQ LWLARMAPYA       120
     TPAFLEELRS VDPANVPATT VEGEPQLVGQ DGDLPIARIT TDGGRLDLVL ARSGSTCVVS       180
     DIRSSDDVPG APTPVLTATP KAGG                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page