(data stored in SCRATCH zone)

EMBL: CP002343.PE280

CP002343.PE280       Location/Qualifiers
FT   CDS             309975..310739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0287"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: kse:Ksed_22440 predicted hydrolase or acyltransferase
FT                   of alpha/beta superfamily; PFAM: alpha/beta hydrolase fold;
FT                   SPTR: Alpha/beta hydrolase fold protein; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46842"
FT                   /db_xref="GOA:E6S6V6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V6"
FT                   /protein_id="ADU46842.1"
FT                   /translation="MSIAHRVVGSGPRTVIVSHGWFGSSEGWGLFPDYLDGDANTYLFA
FT                   DLRGYGARRDVEGNQTLDEIADDLIALADEHGAERFALLGHSMSGAFIQRVLARVPERV
FT                   EALVALSPVSSSPFPFDDAGRELFWGAVDDRDKRYAIIDYTTGNRNCAPWVNRMVDFSL
FT                   ATSTRDAFANALEAWANPDFADEVRGSDAPVLVLVGEHDPALSADYARAYWLPLFTKAK
FT                   IEVIPNAGHYAMFETPVNLATRIDDFLKDVGS"
     MSIAHRVVGS GPRTVIVSHG WFGSSEGWGL FPDYLDGDAN TYLFADLRGY GARRDVEGNQ        60
     TLDEIADDLI ALADEHGAER FALLGHSMSG AFIQRVLARV PERVEALVAL SPVSSSPFPF       120
     DDAGRELFWG AVDDRDKRYA IIDYTTGNRN CAPWVNRMVD FSLATSTRDA FANALEAWAN       180
     PDFADEVRGS DAPVLVLVGE HDPALSADYA RAYWLPLFTK AKIEVIPNAG HYAMFETPVN       240
     LATRIDDFLK DVGS                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page