(data stored in ACNUC7421 zone)

EMBL: CP002343.PE282

CP002343.PE282       Location/Qualifiers
FT   CDS             312134..313156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4025 NB-ARC domain-containing
FT                   protein; SPTR: Putative WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46844"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V8"
FT                   /protein_id="ADU46844.1"
FT                   /translation="MPTISPDAQRVAVQHYGPGQTLELRSAADGAVRWSKTLEDLGDQS
FT                   PEGPLEDMADGVVWLDASTLAVVGATQWLELDADSGAIEKAHPFPDQLPFITEVRDFGG
FT                   GRFGVSVEGDQTLVIDRSRPTDGGQRIDGYLFGHPGTGRAVTVVEHKADNTMALTPLRS
FT                   TRDPRPAGGSVTVDGFAPWVSFTRDGAQLVVCVENRVELRDARTGALRRTFVGHSGSVM
FT                   QARVAGSARPGLDGRAGRRDRFGELPLGECPGDCQVAATAMSPDGATAYGSVEYIVDMG
FT                   PGDRGVVVAWDAATGERRATWPTPWPAYSISVTLSGRTALLNGRWGWGLMDLSSGALVW
FT                   "
     MPTISPDAQR VAVQHYGPGQ TLELRSAADG AVRWSKTLED LGDQSPEGPL EDMADGVVWL        60
     DASTLAVVGA TQWLELDADS GAIEKAHPFP DQLPFITEVR DFGGGRFGVS VEGDQTLVID       120
     RSRPTDGGQR IDGYLFGHPG TGRAVTVVEH KADNTMALTP LRSTRDPRPA GGSVTVDGFA       180
     PWVSFTRDGA QLVVCVENRV ELRDARTGAL RRTFVGHSGS VMQARVAGSA RPGLDGRAGR       240
     RDRFGELPLG ECPGDCQVAA TAMSPDGATA YGSVEYIVDM GPGDRGVVVA WDAATGERRA       300
     TWPTPWPAYS ISVTLSGRTA LLNGRWGWGL MDLSSGALVW                             340
//

If you have problems or comments...

PBIL Back to PBIL home page