(data stored in ACNUC7421 zone)

EMBL: CP002343.PE285

CP002343.PE285       Location/Qualifiers
FT   CDS             complement(314186..314905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_3734 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46847"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W1"
FT                   /protein_id="ADU46847.1"
FT                   /translation="MFGRPAATPQPLDTVPDGVPVLSRGRHRNPRKGACFMEMASYLAG
FT                   ERWSDHPKCTHAVLASLARCVNDALGDVRRQELAVMIPEVVGLNPDDRRVAPLLMRRAA
FT                   LAALPIASAERQNIMALAVMGAERHLNDLAGRDPDELTPETTAALAAVPGAEKWAHDFV
FT                   RRVGTRDLRAEAAAKVVALAVNGIARACVDDPSADLVRLLRQAIDDTKAVAAEQAASRT
FT                   TAALPMAMQEVRSQAAH"
     MFGRPAATPQ PLDTVPDGVP VLSRGRHRNP RKGACFMEMA SYLAGERWSD HPKCTHAVLA        60
     SLARCVNDAL GDVRRQELAV MIPEVVGLNP DDRRVAPLLM RRAALAALPI ASAERQNIMA       120
     LAVMGAERHL NDLAGRDPDE LTPETTAALA AVPGAEKWAH DFVRRVGTRD LRAEAAAKVV       180
     ALAVNGIARA CVDDPSADLV RLLRQAIDDT KAVAAEQAAS RTTAALPMAM QEVRSQAAH        239
//

If you have problems or comments...

PBIL Back to PBIL home page