(data stored in ACNUC7421 zone)

EMBL: CP002343.PE289

CP002343.PE289       Location/Qualifiers
FT   CDS             complement(318640..319437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0296"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107:
FT                   IPR001972; KEGG: pac:PPA1973 stomatin/prohibitin-like
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: SPFH domain / Band
FT                   7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46851"
FT                   /db_xref="GOA:E6S6W5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W5"
FT                   /protein_id="ADU46851.1"
FT                   /translation="MPGFIAPVLAVLVIVAAVIATSLRVIPQYERGVVFRLGKLRPLYQ
FT                   PGLHLLVPGVFRLQRVDLRVVTLTIPPQEVITKDNVPARVNAVVLFNVVDPEAAVMQVE
FT                   NYAVATSQIAQTTLRSVLGRADLDTLLAHRDDLNRDLREIIELQTKPWGVDVSVVEIKD
FT                   VEIPEQMQRAMAREAEAERERRAKVINARGELQASGELKQAADVLSQSPASLQLRYLQT
FT                   LLELGADQNSTVVFPLPMDIVGPLLNRLAPPPANPPANPPASS"
     MPGFIAPVLA VLVIVAAVIA TSLRVIPQYE RGVVFRLGKL RPLYQPGLHL LVPGVFRLQR        60
     VDLRVVTLTI PPQEVITKDN VPARVNAVVL FNVVDPEAAV MQVENYAVAT SQIAQTTLRS       120
     VLGRADLDTL LAHRDDLNRD LREIIELQTK PWGVDVSVVE IKDVEIPEQM QRAMAREAEA       180
     ERERRAKVIN ARGELQASGE LKQAADVLSQ SPASLQLRYL QTLLELGADQ NSTVVFPLPM       240
     DIVGPLLNRL APPPANPPAN PPASS                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page