(data stored in ACNUC7421 zone)

EMBL: CP002343.PE29

CP002343.PE29        Location/Qualifiers
FT   CDS             complement(28975..31014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4736 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46591"
FT                   /db_xref="GOA:E6SEJ0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ0"
FT                   /protein_id="ADU46591.1"
FT                   /translation="MAGKRLVRTGPTRLVGRLLIVLFFSIVAGVAVGSEAIATPALPAA
FT                   PWDCKDAPIAAMPDSGLPGFFDPAPDPIPPQGDPFAATRSTTVYDQYGYAGLSWSTYDL
FT                   GCGGAVRDIEATTDTFLGNFFFSGATWMASATNGIHNKVAHPDEYMAPLDVVVGTVTQR
FT                   MHERIWSPWGMVAFLGVAALLLAYSLRGHLSSVMTAAAWALLVVAVLSGISQYPTRTAS
FT                   FFDETVTQSIASINQTSAGLTPSAGADPTRAQGALIVDDVLYQAWLRGQFGDPNSAAAQ
FT                   KWGPVLFRESTFSRTEAATASSTPDGIQKMTEQKANDWVTTTQEIQEQDPIAYAAVQGK
FT                   SKGRAGAGFMAFIGVLFTGLFRLVADLFMFAGLVMLRLLVMFFPAAAVFGVLAPMASIV
FT                   RRIGNIAGASVINVIAFGAGSAIHTVLIAAILFRADGAGMGVLSFVLCLVVTVAAFIML
FT                   MPLLSLTNVLGRPSSTQTLLRRAGRRVRRRHLRRGRHGEGDDDDDEEEDESEEDEDEEE
FT                   APRRRSGRRRRRSARRTRPPVEAFGRPATVPLSAPVSAGDPGVHTTDGRDAGHSLPAAS
FT                   RKSGVPVNAQGSADLRPPTESPAPSGGHGVHRPSTAETPHTRDRVVVGVLVDELPTEIR
FT                   ETPATRIHDSHTEVRPDGVGPRLYDPATKQTVLPEAHSRGVADE"
     MAGKRLVRTG PTRLVGRLLI VLFFSIVAGV AVGSEAIATP ALPAAPWDCK DAPIAAMPDS        60
     GLPGFFDPAP DPIPPQGDPF AATRSTTVYD QYGYAGLSWS TYDLGCGGAV RDIEATTDTF       120
     LGNFFFSGAT WMASATNGIH NKVAHPDEYM APLDVVVGTV TQRMHERIWS PWGMVAFLGV       180
     AALLLAYSLR GHLSSVMTAA AWALLVVAVL SGISQYPTRT ASFFDETVTQ SIASINQTSA       240
     GLTPSAGADP TRAQGALIVD DVLYQAWLRG QFGDPNSAAA QKWGPVLFRE STFSRTEAAT       300
     ASSTPDGIQK MTEQKANDWV TTTQEIQEQD PIAYAAVQGK SKGRAGAGFM AFIGVLFTGL       360
     FRLVADLFMF AGLVMLRLLV MFFPAAAVFG VLAPMASIVR RIGNIAGASV INVIAFGAGS       420
     AIHTVLIAAI LFRADGAGMG VLSFVLCLVV TVAAFIMLMP LLSLTNVLGR PSSTQTLLRR       480
     AGRRVRRRHL RRGRHGEGDD DDDEEEDESE EDEDEEEAPR RRSGRRRRRS ARRTRPPVEA       540
     FGRPATVPLS APVSAGDPGV HTTDGRDAGH SLPAASRKSG VPVNAQGSAD LRPPTESPAP       600
     SGGHGVHRPS TAETPHTRDR VVVGVLVDEL PTEIRETPAT RIHDSHTEVR PDGVGPRLYD       660
     PATKQTVLPE AHSRGVADE                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page