(data stored in ACNUC7421 zone)

EMBL: CP002343.PE290

CP002343.PE290       Location/Qualifiers
FT   CDS             complement(319443..320123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3182 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46852"
FT                   /db_xref="GOA:E6S6W6"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W6"
FT                   /protein_id="ADU46852.1"
FT                   /translation="MRTPSVTVLLVSGYSAVLLVVAWLFDRMGARSAERSARWRTGNFI
FT                   YHEDQDAWKCHQDQWLWPASFDPDKRVIRYEGQHAICGRCPVKTECSPTPGPRELTRQV
FT                   DPWPHSEAGRFHRGIALAVASVAVFMPTAMLLGAHGAGDVIVLVTTVAVGIIAGVPLAQ
FT                   HLWNAPTNFPQHLRSDASSDAPGMPEPTADAAVAPLDHLLDRYQTRWASDRRRVDLPDP
FT                   KTRK"
     MRTPSVTVLL VSGYSAVLLV VAWLFDRMGA RSAERSARWR TGNFIYHEDQ DAWKCHQDQW        60
     LWPASFDPDK RVIRYEGQHA ICGRCPVKTE CSPTPGPREL TRQVDPWPHS EAGRFHRGIA       120
     LAVASVAVFM PTAMLLGAHG AGDVIVLVTT VAVGIIAGVP LAQHLWNAPT NFPQHLRSDA       180
     SSDAPGMPEP TADAAVAPLD HLLDRYQTRW ASDRRRVDLP DPKTRK                      226
//

If you have problems or comments...

PBIL Back to PBIL home page