(data stored in ACNUC7421 zone)

EMBL: CP002343.PE292

CP002343.PE292       Location/Qualifiers
FT   CDS             complement(322651..323331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3173 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46854"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W8"
FT                   /protein_id="ADU46854.1"
FT                   /translation="MTDHLDSRALRGTDTYGQRFMRPGTYRYALGPAGTGRYTQDHPYV
FT                   ITVGEGEPKRGEMRQTLVVVHREGRTLVPDQPKLSINAGDMVMWHAPGAGTRPFVVVGE
FT                   KEFFTSERLVNESGYTHAFTSEGVYEWADAHGSGARGVVRVTNPDVSTAKGQRAWARSQ
FT                   RQGTVVMVNDGQAEPAEVDVVVGQTVFFAVVAGPGITITDQSLLEHDRPGKGGAFYRKA
FT                   APVR"
     MTDHLDSRAL RGTDTYGQRF MRPGTYRYAL GPAGTGRYTQ DHPYVITVGE GEPKRGEMRQ        60
     TLVVVHREGR TLVPDQPKLS INAGDMVMWH APGAGTRPFV VVGEKEFFTS ERLVNESGYT       120
     HAFTSEGVYE WADAHGSGAR GVVRVTNPDV STAKGQRAWA RSQRQGTVVM VNDGQAEPAE       180
     VDVVVGQTVF FAVVAGPGIT ITDQSLLEHD RPGKGGAFYR KAAPVR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page