(data stored in ACNUC7421 zone)

EMBL: CP002343.PE293

CP002343.PE293       Location/Qualifiers
FT   CDS             complement(323345..324148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3174 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46855"
FT                   /db_xref="GOA:E6S6W9"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W9"
FT                   /protein_id="ADU46855.1"
FT                   /translation="MSEIIAAIDEGAANDFLDIVVAGVGPQSTSGSSSLGPFGASYSVT
FT                   GTLTNGTVDLIPPDTIRVADLRLDWTATLTLSIDLGDFLPEIHIPQVCVTIPCVGKVCT
FT                   PAIDITWPTLSVPLSFGDFVKATVDLGIVVGLAGGVWKVEGVVQGVPSLSFGPGTAAIV
FT                   TAIGLAVAAAVAWVPFIGPFLAGLAIAVASAIGVAGLTGWLGPIISPFISGTRFPVYDQ
FT                   PEWFEVLPSAGASDPAVFVHLDAIGAEVQHNAPEDELVLTADISA"
     MSEIIAAIDE GAANDFLDIV VAGVGPQSTS GSSSLGPFGA SYSVTGTLTN GTVDLIPPDT        60
     IRVADLRLDW TATLTLSIDL GDFLPEIHIP QVCVTIPCVG KVCTPAIDIT WPTLSVPLSF       120
     GDFVKATVDL GIVVGLAGGV WKVEGVVQGV PSLSFGPGTA AIVTAIGLAV AAAVAWVPFI       180
     GPFLAGLAIA VASAIGVAGL TGWLGPIISP FISGTRFPVY DQPEWFEVLP SAGASDPAVF       240
     VHLDAIGAEV QHNAPEDELV LTADISA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page