(data stored in SCRATCH zone)

EMBL: CP002343.PE295

CP002343.PE295       Location/Qualifiers
FT   CDS             complement(324964..327327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0302"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017: IPR017900: IPR017896; KEGG: kse:Ksed_26190 Fe-S
FT                   oxidoreductase; PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; SPTR: Putative
FT                   iron-sulphur-binding reductase; PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46857"
FT                   /db_xref="GOA:E6S6X1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6X1"
FT                   /protein_id="ADU46857.1"
FT                   /translation="MTVLQIIAIVISLAITVVGVALLTKTINHYVATFRLGQPEYRGDD
FT                   KGARTVTLVREFLGHTRMSRLPVVAIAHWFTMVSFGILFFTLINAFGQLFEPSWTLPLI
FT                   GHFPPYEWITEFFAWTGLLGIVLLMAIRQQNHPRSAAGEHGRRSRFFGSTWWQAYYVEL
FT                   TILGVTLCILALRVLEYALAKVEGLDTASALNFPMTAWLGESFTGLSVAALEGAIVVIA
FT                   TLKILISMAWMITIALNPTMGVAWHRFLAFFNIFWKRHADGRTSLGELQPIRVNGEPLD
FT                   FENVDDLDEDAALGVGKIEDFTWKGLLDFTTCTECGRCQSQCPAWNTDKPLSPKLLVMS
FT                   LRDHAHAKAPWLQASEEVRAKGIDAGSFSERTKAAVAVDQLVGETGYDITDPLGAYQPY
FT                   GAPDGGGAVIDQDVLWSCTTCGACVEQCPVDIEHVDAIVDMRRYKNLIESAFPSELGGL
FT                   FKNLEKNANPWGLAPRLRMDWAKDLPFDVPQVGGSGSSDVEALEDVDYLFWVGCAGAYE
FT                   DRAKKTTRAVAELLHLADVRFAVLGDGEACTGDSARRAGNEFLFQMLAQQNVEVLNEVG
FT                   ATKIVVTCAHCFNTIKNEYPQLGGTYEVLHHTQLLNRLVREKRLTPVARPGDGDGLGMS
FT                   RAGSTGSKVTYHDPCYLGRHNQVYAPPRELLQILPGVEYAEMERSGEKSFCCGAGGARM
FT                   WMEEKLGTRINTNRTEEALATGADRIAIGCPFCKVMLTDGLNAAVQEGKKAEGEVEVVD
FT                   VAQMLLAAVRRGDGGASVEQAHAVPDAPTPEPAI"
     MTVLQIIAIV ISLAITVVGV ALLTKTINHY VATFRLGQPE YRGDDKGART VTLVREFLGH        60
     TRMSRLPVVA IAHWFTMVSF GILFFTLINA FGQLFEPSWT LPLIGHFPPY EWITEFFAWT       120
     GLLGIVLLMA IRQQNHPRSA AGEHGRRSRF FGSTWWQAYY VELTILGVTL CILALRVLEY       180
     ALAKVEGLDT ASALNFPMTA WLGESFTGLS VAALEGAIVV IATLKILISM AWMITIALNP       240
     TMGVAWHRFL AFFNIFWKRH ADGRTSLGEL QPIRVNGEPL DFENVDDLDE DAALGVGKIE       300
     DFTWKGLLDF TTCTECGRCQ SQCPAWNTDK PLSPKLLVMS LRDHAHAKAP WLQASEEVRA       360
     KGIDAGSFSE RTKAAVAVDQ LVGETGYDIT DPLGAYQPYG APDGGGAVID QDVLWSCTTC       420
     GACVEQCPVD IEHVDAIVDM RRYKNLIESA FPSELGGLFK NLEKNANPWG LAPRLRMDWA       480
     KDLPFDVPQV GGSGSSDVEA LEDVDYLFWV GCAGAYEDRA KKTTRAVAEL LHLADVRFAV       540
     LGDGEACTGD SARRAGNEFL FQMLAQQNVE VLNEVGATKI VVTCAHCFNT IKNEYPQLGG       600
     TYEVLHHTQL LNRLVREKRL TPVARPGDGD GLGMSRAGST GSKVTYHDPC YLGRHNQVYA       660
     PPRELLQILP GVEYAEMERS GEKSFCCGAG GARMWMEEKL GTRINTNRTE EALATGADRI       720
     AIGCPFCKVM LTDGLNAAVQ EGKKAEGEVE VVDVAQMLLA AVRRGDGGAS VEQAHAVPDA       780
     PTPEPAI                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page