(data stored in ACNUC7421 zone)

EMBL: CP002343.PE299

CP002343.PE299       Location/Qualifiers
FT   CDS             330856..331059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0306"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="COGs: COG1278 Cold shock protein; InterPro
FT                   IPR002059: IPR012156: IPR011129: IPR019844; KEGG:
FT                   xce:Xcel_1267 cold-shock DNA-binding domain protein; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein;
FT                   SPTR: Cold shock protein; PFAM: 'Cold-shock' DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46861"
FT                   /db_xref="GOA:E6S7G6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G6"
FT                   /protein_id="ADU46861.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAQDGGGPDVFVHYSAIQSNGYRSLDEA
FT                   QRVEFEVTQGPKGPQADAVRPL"
     MAQGTVKWFN AEKGFGFIAQ DGGGPDVFVH YSAIQSNGYR SLDEAQRVEF EVTQGPKGPQ        60
     ADAVRPL                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page