(data stored in SCRATCH zone)

EMBL: CP002343.PE3

CP002343.PE3         Location/Qualifiers
FT   CDS             3881..5005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="COGs: COG1023 6-phosphogluconate dehydrogenase;
FT                   InterPro IPR006115: IPR006114: IPR004849: IPR006183; KEGG:
FT                   kse:Ksed_00030 6-phosphogluconate dehydrogenase
FT                   (decarboxylating); PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase
FT                   domain-containing protein; SPTR: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; TIGRFAM: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; manually curated; PFAM:
FT                   6-phosphogluconate dehydrogenase, C-terminal domain; NAD
FT                   binding domain of 6-phosphogluconate dehydrogenase;
FT                   TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46565"
FT                   /db_xref="GOA:E6SDW2"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW2"
FT                   /protein_id="ADU46565.1"
FT                   /translation="MQLGLIGLGRMGGNMRERLRRAGHEVVGYDRNPDVSDAASLEAMV
FT                   EGLSAPRVVWVMVPSGDPTRDTVARLAELLEPDDLVIDGGNSRFTDDFENAKLLAEKQI
FT                   GYVDCGVSGGIWGLENGYGLMCGGDARWIERAMPIFDALRPEGPREEGFVHAGEVGAGH
FT                   YAKMVHNGIEYGLMHAYAEGFELLEAKDIVKDVPGTFQAWSRGTVVRSWLLDLMVDALE
FT                   ENPHLDDVSDYTNDSGEGRWTVEEAIALGVPVPVISASLFARFASRQQVSPAMQAVSAL
FT                   RGQFGGHQVMTVAEGVALREGSVPAEPSKQAKVTHDEQSFDEKGKASARAFQEASRANV
FT                   ETAGEAVEAGAPPKTQRTDAVDTALGTERSKQAD"
     MQLGLIGLGR MGGNMRERLR RAGHEVVGYD RNPDVSDAAS LEAMVEGLSA PRVVWVMVPS        60
     GDPTRDTVAR LAELLEPDDL VIDGGNSRFT DDFENAKLLA EKQIGYVDCG VSGGIWGLEN       120
     GYGLMCGGDA RWIERAMPIF DALRPEGPRE EGFVHAGEVG AGHYAKMVHN GIEYGLMHAY       180
     AEGFELLEAK DIVKDVPGTF QAWSRGTVVR SWLLDLMVDA LEENPHLDDV SDYTNDSGEG       240
     RWTVEEAIAL GVPVPVISAS LFARFASRQQ VSPAMQAVSA LRGQFGGHQV MTVAEGVALR       300
     EGSVPAEPSK QAKVTHDEQS FDEKGKASAR AFQEASRANV ETAGEAVEAG APPKTQRTDA       360
     VDTALGTERS KQAD                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page