(data stored in ACNUC7421 zone)

EMBL: CP002343.PE302

CP002343.PE302       Location/Qualifiers
FT   CDS             complement(334743..335240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_7098 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46864"
FT                   /db_xref="GOA:E6S7G9"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G9"
FT                   /protein_id="ADU46864.1"
FT                   /translation="MSEHAPYDREETRGERLDRNFDEQLQEARIAQAGVQILFGFLLTL
FT                   PFQQRFETLTDFQRKIYLGTLLASAVAVVLFTAPVAVHRVLFRQGLKDFIVAYTSKLAS
FT                   VGLVALALSVVGGLVLVLDVLIAHTLAMWVGGAVAALTVVLWYLVPAARKRRVAPPEKP
FT                   ES"
     MSEHAPYDRE ETRGERLDRN FDEQLQEARI AQAGVQILFG FLLTLPFQQR FETLTDFQRK        60
     IYLGTLLASA VAVVLFTAPV AVHRVLFRQG LKDFIVAYTS KLASVGLVAL ALSVVGGLVL       120
     VLDVLIAHTL AMWVGGAVAA LTVVLWYLVP AARKRRVAPP EKPES                       165
//

If you have problems or comments...

PBIL Back to PBIL home page